KEGG   Burkholderia sp. RPE64: BRPE64_ACDS03770Help
Entry
BRPE64_ACDS03770  CDS       T02684                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
buo  Burkholderia sp. RPE64
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_ACDS03770
  Amino acid metabolism
   00380 Tryptophan metabolism
    BRPE64_ACDS03770
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BRPE64_ACDS03770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:380310..381782
Genome map
AA seq 490 aa AA seqDB search
MTTQRLTTAAGAPVGDNQNSQTAGPRGPVTLQDFWLVEKLAHFDREVIPERRVHAKGSGA
FGTFRVTHDISRFTKAKLFDAIGKETPIFMRFSTVAGERGAADAERDVRGFSIKFYTEEG
NWDVVGNNTPVFFIRDPLKFPDFIHTQKRDPYTNMRSNVAAWDFWSRHPESLHQVTILMS
DRGIPKNYRQMHGFGSHTYSFINEDNERFYVKFHFKSQQPLENYTDAEAAAVIANDRESA
QRDLVTNIDEGNFPRWNFRIQIMSEEQAAQARVNPFDITKVWSHKAFPLIDVGVIELNRN
AQNYFADVEQAAFTPANVVPGIGFSPDRLLQGRLFSYGDTQRYRLGINHHQIPVNAPRMA
SANTFHRDGAMRTDGNLGGRVNYEPNRYGEFAQDASVNEPALAAGAVHRYDHREDDDYYS
QPAALFKLFDDAQRERFFGNIARHMHGVPNDIVVRQIGHFRRIDPVYAQGVIDALAKLGQ
TIDTEEPAAS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccaacgactcacgaccgcagccggcgcgcccgtcggcgacaaccagaattcg
cagacggccggcccgcgcggccctgttacgttgcaggacttctggctcgtcgaaaagctc
gcgcacttcgaccgcgaagtgattcccgagcgccgcgtgcacgcgaagggctcgggcgcg
ttcggcacgttccgcgtgacgcacgacatttcgcgcttcacgaaggcaaagctgttcgac
gcaatcggcaaggaaacgcccattttcatgcgcttttcgacggtcgccggcgagcgcggc
gcggccgacgccgagcgcgacgtgcgcggtttctcgatcaagttctacacggaagaaggc
aactgggacgtggtgggcaataacacgccggtgttcttcatccgcgatccgctcaagttt
ccggacttcatccacacgcaaaaacgcgatccgtacacgaacatgcgcagcaacgtggcg
gcgtgggatttctggtcgcgtcatccggaatcgttgcatcaggtcacgatcctgatgagc
gatcgcggcattccgaagaactatcggcagatgcacggtttcggctcgcacacgtactcg
ttcatcaacgaggacaacgagcgcttctacgtgaagttccatttcaagtcgcagcagccg
ctcgaaaactacacggatgccgaagccgccgccgtgatcgcgaacgaccgcgagagcgcg
cagcgcgacctggtgacgaacatcgacgagggcaacttcccgcgctggaatttccgcatt
cagatcatgagcgaggagcaggcagcacaggcgcgcgtgaatccgttcgacatcaccaaa
gtgtggtcgcacaaagcgtttccgctgatcgatgtcggcgtgatcgagctgaaccgcaat
gcgcagaactatttcgcggacgtggagcaggccgcgttcacgccggcgaacgtggtgccg
ggcatcggcttttcgccggaccgcttgctgcagggccggctgttttcctacggcgatacg
cagcgttaccggctcggcatcaaccatcatcagattccggtgaatgcgccgcgtatggcg
agcgccaacacgtttcatcgcgatggcgcgatgcgcaccgacggcaatctcggcggccgc
gtgaactacgagccgaatcgctacggtgaattcgcacaggacgcgagcgtgaacgagccg
gcgctcgcggcaggcgcggtgcatcgctatgaccatcgcgaagacgacgattactacagc
cagccggccgcgctcttcaaactgttcgacgatgcgcagcgcgagcgcttcttcggcaac
atcgcgcggcatatgcacggcgtgccgaatgacatcgtcgtgcgacagatcgggcatttt
cgccgcatcgatccggtatatgcacaaggtgtcatcgacgcgctcgcgaagctcggccag
acgatcgacacggaagaacccgccgcttcctga

DBGET integrated database retrieval system