KEGG   Burkholderia sp. RPE64: BRPE64_ACDS05840Help
Entry
BRPE64_ACDS05840  CDS       T02684                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
buo  Burkholderia sp. RPE64
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:buo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:buo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:614758..615954
Genome map
AA seq 398 aa AA seqDB search
MLNSSLEFLANGLLDFSWWQILLFTLAMTHVTIAGVTIYLHRCQAHRALDLHPVVSHFFR
FWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRTEAKNEETM
RKFSHGTPNDWLERNLYTRYPILGISVMMVIDVALFGIVGLSVWAVQMIWIPFWAAGVVN
GLAHFWGYRNFNSADASTNIFPLGILIGGEELHNNHHTFATSAKLSSKWYEFDIGWMYIR
IMSAFRLAKVKKIAPTPKLAASKAVVDQDTLQAVLSNRYEVMARYGKALKRAYAQEMEKL
KEAGAREKYQLMRGARKWFHKEEDGLNEPQLKQLPELTSDNQRLRTFIELRKDLSSMWDR
SNASREQLVTQLQDWCHRAEESGIKALQDFALRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaattcttccctcgaatttctcgccaacggattgctcgacttttcctggtggcag
attctgctgttcacgctcgcgatgacgcacgtcaccatcgccggcgtcactatctatttg
caccgctgccaggcgcaccgcgcgctggatctgcaccccgtcgtgagccatttcttccgc
ttctggctgtggatgaccacgggcatgctgacgggccagtgggcggcaattcaccgcaag
caccacgccaaatgcgagaccgaagaagatccgcatagcccgcagacgcgcggcatttgg
aaggtcttgctcgaaggcgccgaactctatcgcacggaagcgaaaaacgaagaaacgatg
cgcaagttcagccacggcacgccgaatgactggctcgagcgcaacctctacacgcgttat
ccgattctcggcatcagcgtcatgatggtgatcgacgtcgcgctgttcggcatcgtcggg
ctgtcggtgtgggccgtgcagatgatctggattccgttctgggcggcgggcgtcgtcaac
ggtcttgcgcacttctggggttatcgcaacttcaactcggcggacgcgtccaccaacatc
ttcccgctcggtattctcatcggcggcgaagaactgcataacaatcaccacacgttcgcc
acgtccgcgaagctttccagcaagtggtacgagttcgatatcggctggatgtatatccgc
atcatgtcggcgttccgtctcgccaaggtgaagaaaatcgcgccgacgccgaagctcgcc
gccagcaaggccgttgtcgatcaggacacgctgcaggccgtgctgtcgaaccgctacgaa
gtgatggcgcgttacggcaaggcgctcaagcgcgcctatgcgcaggaaatggagaagctg
aaggaagccggcgcgcgcgagaagtatcaactgatgcgcggtgcccgcaagtggttccac
aaggaagaagacggcctgaacgagccgcagctcaagcaactgccggaactgacttcggac
aatcagcgtttgcgtaccttcatcgaactgcgcaaggatctgtcgtcgatgtgggaccgc
tcgaatgcgtcgcgcgaacagcttgtcacgcaattgcaggactggtgccatcgtgcggaa
gaaagcggcatcaaggcgctgcaggatttcgcgctgcgtctgcgccgctacgcctga

DBGET integrated database retrieval system