KEGG   Burkholderia sp. RPE64: BRPE64_ACDS13270Help
Entry
BRPE64_ACDS13270  CDS       T02684                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
buo  Burkholderia sp. RPE64
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BRPE64_ACDS13270
   01230 Biosynthesis of amino acids
    BRPE64_ACDS13270
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRPE64_ACDS13270
   00290 Valine, leucine and isoleucine biosynthesis
    BRPE64_ACDS13270
Enzymes [BR:buo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BRPE64_ACDS13270
    2.6.1.66  valine---pyruvate transaminase
     BRPE64_ACDS13270
Amino acid related enzymes [BR:buo01007]
 Aminotransferase (transaminase)
  Class I
   BRPE64_ACDS13270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1368315..1369553
Genome map
AA seq 412 aa AA seqDB search
MKPILKSNKLQNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFEAPDEIIQDMIR
NLPGSSGYSDSKGVFAARKAIMHYTQQKGVTGVELDDIYIGNGASELIVMAMQALLNDGD
EVLLPAPDYPLWTAAVSLSSGTPRHYMCDESNGWMPDLDDIRAKITPNTKALVVINPNNP
TGALYSDELLLDLISIAREHGLIIFADEVYDKIIYDGMTHTSMAALSEDVITVTFNSLSK
SYRSCGYRAGWMAISGLIEENRRRAKDYLEGLGILASMRLCPNVPGQYAIQTALGGYQSI
NDLILPGGRLFKQRELAYDMLTAIPGVSCVKPQAALYMFPKLDPKMYPIQDDQQFITDLL
LEERVLLVQGTGFNWPTPDHFRVVFLPNVDDLADSINRIARFLDGYRKRHFA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattctcaaatccaacaagctgcaaaacgtctgctacgacattcgcgggccc
gtgctcgaacacgcgaagcgcctcgaagaggaaggccatcgcatcatcaagctcaatatc
ggcaatttggcgccgttcggcttcgaggcgccggacgagatcattcaggacatgatccgc
aatctgccgggcagttcgggctattcggattcgaagggcgtgttcgccgcgcgcaaggcg
atcatgcattacacgcagcaaaagggcgtgacgggcgtcgaactggacgacatctacatc
ggcaacggcgcgtcggaactcatcgtcatggcgatgcaggccttgctcaacgacggcgac
gaagtgctcctgcccgcgcccgactatccgctctggacggctgcggtgagcctgtcgtcc
ggcacgccgcgccattacatgtgcgacgagagcaacggctggatgcccgatctcgacgac
atccgcgcgaagatcacgcccaacacgaaggcgctcgtcgtcatcaacccgaacaatccg
accggcgcgctgtattcggacgaattgctgctcgatctgatttcgatcgcgcgcgagcac
ggcttgatcattttcgcggacgaggtctacgacaagatcatctacgacggcatgacgcat
acgtcgatggccgcgctctccgaagacgtgatcaccgtcacgttcaacagtttgtcgaag
agctatcgttcgtgcggttatcgggcgggctggatggccatttccggtctgatcgaagag
aatcgccggcgcgcgaaggattatctcgaaggcctcggcattctggcctcgatgcgcctg
tgcccgaacgtgcccggccagtacgcgatccagacggcgctgggcggctatcagagcatc
aatgacctgatcttgccgggcggacggctcttcaagcagcgcgaactcgcctacgacatg
ctcacggccattccgggcgtgagctgcgtgaagccgcaagccgcgctgtacatgttcccg
aagctcgatccgaagatgtacccgatccaggacgaccagcagttcatcaccgacctgctg
ctcgaggagcgcgtgctgctcgtgcagggtacgggcttcaactggccgacgccggatcac
ttccgcgtggtcttcctgccgaacgtcgacgatctcgcggattcgatcaaccgcatcgcg
cgcttcctcgacggctatcgcaaacggcatttcgcttaa

DBGET integrated database retrieval system