KEGG   Burkholderia sp. RPE64: BRPE64_ACDS24520Help
Entry
BRPE64_ACDS24520  CDS       T02684                                 

Gene name
dsbC
Definition
putative thiol-disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
buo  Burkholderia sp. RPE64
Brite
Enzymes [BR:buo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BRPE64_ACDS24520 (dsbC)
Secretion system [BR:buo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BRPE64_ACDS24520 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2559396..2560127)
Genome map
AA seq 243 aa AA seqDB search
MKTIYRFALTTAAALAVTLGLGCSAQADQTTDKIKSALEARMGDATIKSIEKTPVPGLYE
VNLGSQIVYSDATGNYVLIGDLVDTRSSKNLTEARLAETNKIDFAKLPLENAVKVVKGNG
SRKIAVFSDPNCPYCKQLESTLKSIDNVTVYTFLYPVLSPDSTVKSKSIWCAKDRGMSWE
GWMLDHKAPTTAANCDTTAIDKNLKLGRSMNVTGTPTVFLADGRRLPGAIPADRLEKELS
AAH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatctatcgtttcgccctcacgacggccgccgcacttgctgtcacgctcggc
ctcggctgttcggcccaggccgaccagactaccgacaagatcaagtcggcgctcgaagcg
cgcatgggcgacgccaccatcaagagcatcgagaagacgccggttcccggcctctacgaa
gtgaatctcggctcgcagatcgtctacagcgacgcgaccggcaattacgtgctgatcggc
gatctcgtcgatacgcgcagcagcaagaatctcaccgaagcgcggctcgcggaaaccaac
aagatcgacttcgcgaagctgccgctcgaaaacgcggtgaaggtcgtgaagggcaacggc
agccgcaagatcgccgtgttctccgatccgaactgtccgtactgcaagcaactcgaatcg
acgctcaagtccatcgacaacgtgaccgtctacaccttcctgtatccggtgctctcgccg
gattcgacggtcaagtcgaaatcgatctggtgcgcgaaagatcgcggtatgtcgtgggaa
ggctggatgctcgatcacaaggcgccgaccaccgccgccaattgcgacacgaccgccatc
gacaaaaatttaaagctcggccgttcgatgaacgtcaccggcacgccgaccgtgttcctc
gccgatggccggcgtctgccgggcgccatacccgccgaccggctggaaaaggaattgtcc
gccgcgcactga

DBGET integrated database retrieval system