KEGG   Burkholderia sp. RPE64: BRPE64_BCDS04800Help
Entry
BRPE64_BCDS04800  CDS       T02684                                 

Gene name
bcsZ
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
buo  Burkholderia sp. RPE64
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRPE64_BCDS04800 (bcsZ)
Enzymes [BR:buo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BRPE64_BCDS04800 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(478721..479872)
Genome map
AA seq 383 aa AA seqDB search
MRVSTAHVFAGALIAASAASATAAQPCDWPAYRLFVERVVQADGRVVDRSTDTQQTTSES
QSYGMFFALVANDRATFERLLGWTRANLSANQFDANNVRLPAWQWGRKQDGSFGVMDPNS
ASDSDLWIAYDLFQAGRLWKEPMYTKLAYALATQIVKQEIVDLPGLGPMLLPGPQGFRTG
DVTRLNPSYLPLPLLRGLAHEMPDGPWNALAQSAAKMIKVTAPRGYAPDWAAYQTSQNGQ
FVVDPKNGDIGSYDAIRVYLWAGMTASGDPLARPWLDALGGMRQSVAQNGFPPEKVSTIS
GAATGEGPLSYWGALAPYFKALNDERSLGLARTHLEALVAPPGAGREPVYYDRVLGLFGG
GFIDGRYRFDENGRLLPKWRSAC
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtatccaccgcccatgtttttgccggtgcattgatcgccgcttcggcggcgagc
gccaccgccgcgcagccctgcgactggccggcgtatcgccttttcgtcgagcgtgtcgtg
caggcggatggccgcgtcgtcgaccgctcgaccgacacgcagcaaaccacgtccgaaagt
cagtcctacggcatgttcttcgcgctcgtcgccaacgaccgcgccaccttcgagcgcctg
ctcggctggacgcgcgcgaatctctcggccaatcagttcgatgcgaacaacgtgcgcctg
cccgcgtggcaatggggcagaaagcaagacggctcgttcggcgtgatggacccgaattcc
gccagcgactcggacctgtggatcgcctacgacctgttccaggctggccggctgtggaag
gaaccgatgtacacgaagctcgcctacgcgctcgcgacgcagatcgtgaagcaggagatc
gtcgatctgccgggcttggggccgatgctcctgcccggcccgcaaggctttcgcaccggc
gacgtcacgcgtctgaatccgagctatctgccgctgccgctgctgcgcggcctcgcgcac
gaaatgcccgacggcccgtggaatgcgctcgcgcagagcgccgcgaagatgatcaaggtc
accgcgccgcgcggctatgcgccggactgggccgcttatcaaaccagccagaacggccag
ttcgtcgtcgatccgaagaacggcgacatcggcagttatgatgcgatccgcgtctatctc
tgggccggcatgacggcaagcggcgatccgctcgcgcggccgtggctcgatgcgctcggc
ggcatgcgccagagcgtcgcgcagaacggcttcccgccggagaaggtctcgaccatcagc
ggcgcagcgaccggcgaaggtccgctgtcttactggggcgcgctcgcgccgtatttcaag
gcactgaacgacgagcgcagtttgggtctcgcccgcacgcatctcgaagcgctggtcgcg
ccgccgggcgccggccgcgaaccggtctactacgaccgcgtgctgggcctgttcggcggc
ggtttcatcgacgggcgttatcgcttcgatgaaaacggccgtctcttgccgaagtggaga
agcgcatgctga

DBGET integrated database retrieval system