KEGG   Burkholderia sp. RPE64: BRPE64_BCDS12510Help
Entry
BRPE64_BCDS12510  CDS       T02684                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
buo  Burkholderia sp. RPE64
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRPE64_BCDS12510 (glgB)
Enzymes [BR:buo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BRPE64_BCDS12510 (glgB)
Exosome [BR:buo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRPE64_BCDS12510 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1273440..1275677
Genome map
AA seq 745 aa AA seqDB search
MELTMNTRSDPADTRNPAHGLNPLDIDALVEARHPDPFSMLGMHQTELGHVVRVFLPGAS
AVNIVDAASGEHLGSLARIRDAGLFAGFVERPAAYRLQIDWHGTPQETHDTYSFGPVLSD
EWLTRLSQADPYAVLECLGSRPVTHGNVAGARFAVWAPNARRVSVVGDFNTWDGRRHPMR
LRHNAGVWELFVPGIGAGTRYKYEIVTREGVTLPLKADPCAMQSEKPPSTASVVADADAI
DHYAWTDADWMATRAGKQTAQSPLTIYEAHAESWLRVPEDGNRGMNWHELAERLIPYAKG
MGFTHLEFMPIAEHPFGGSWGYQPLGQFAPSARFGTPEQFAEFVNRAHEAGLGVIIDWVP
AHFPNDAHGLVQFDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIASGLAWLKRYH
VDGLRVDAVASMLYRDYSRKTGEWVPNVHGGRENLESIAFLKRLNHEVRHIPGAITIAEE
STAWPGVTASVESGGLGFDFKWNMGWMHDTLHYMEEDPVYRQYHHHLYTFGMVYAYSERF
VLPLSHDEVVHGKGSLIGKMPGDRWQKFASLRAYFGFMWTHPGKKLLFMGGEFGQFAEFN
HDESPHWHLLDDSLHGGLQKAVRDLNLLYTSEPALHKLDSDARGFEWIVGDDNANSVYAY
RRTDAEGRELVVVCNMTPVPRLAYRIGMPRGGRWSEVFNSDASIYGGSNMGNGGVIHTDD
YPSHGRGQSAALTLPPLATIVLRAD
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaactcaccatgaacactcgtagcgatccggcggatacccgaaacccggcacacgga
ctcaatccgctcgacatcgacgcactcgtcgaggcgcgccatcccgacccgttttcgatg
ctcggcatgcatcagaccgaactggggcatgtcgtgcgcgtgtttctgccgggcgcgtcg
gcggtgaatatcgtcgatgcggcaagcggcgagcatctcggctcgcttgcgcgcattcgc
gatgcggggctctttgcaggcttcgtcgagcggccagcggcgtatcgcctgcaaatcgac
tggcacggcaccccgcaggaaacccacgacacatattcgttcggtcccgtgttgtccgac
gaatggctcacgcgtctttcgcaggcggatccgtacgcagtgctcgaatgcttaggctcg
cggccggtcacgcacggcaatgtggcgggcgcgcgcttcgcggtatgggcaccgaatgcg
cgtcgcgtgtcggtggtcggcgacttcaacacgtgggacggccgccgtcatccgatgcgt
ctgcgccataacgcgggcgtctgggaactgttcgtgcccggcatcggcgcgggcacgcgc
tacaagtacgagatcgtcacgcgcgaaggagtcacgctgccgctcaaggccgatccgtgc
gcgatgcagagcgagaagccgccttcgacggcatcggtcgtcgcggatgcggatgccatc
gatcactacgcatggaccgatgcagactggatggccacacgcgccggcaagcagactgcg
cagtcgccgctcaccatctacgaggcgcacgccgagtcgtggctgcgcgtgccggaagac
ggcaatcgcggcatgaactggcacgaactcgccgagcgtctgatcccgtatgccaagggc
atgggcttcacgcacctcgaattcatgccgattgccgagcatccgttcggcggctcgtgg
ggctatcaaccgctcgggcagttcgcgccgtctgcgcgcttcggcacgccggagcagttc
gcggagttcgtgaaccgcgcgcacgaggcggggctcggcgtgatcatcgactgggtgccg
gcgcactttccgaacgatgcgcacggcctggtgcaattcgacggcacgccgctctacgag
cacgcggacccgcgcgaaggctatcaccaggactggaacacgatgatctacaacctcggc
cgcaacgaggtgagcgcgttcctgatcgcatcggggctggcgtggctcaagcgctatcac
gtcgatggactgcgcgtggatgccgtcgcgtcgatgctgtatcgcgactattcacgcaag
accggcgaatgggtgccgaacgtgcatggcggccgcgagaatctcgaatcgatcgcgttt
ttgaagcggctcaatcacgaagtgcggcacattccgggcgcgatcaccatcgccgaggaa
tcgacggcgtggcccggcgtgacggcgagcgtcgagagcggtggcctgggcttcgacttc
aagtggaacatgggctggatgcacgacacgctgcattacatggaggaagatccggtctat
cgccagtatcaccatcatctttatacgttcgggatggtgtatgcgtattccgagcgtttc
gtgctgccgctgtctcacgacgaggtcgtgcacggcaagggatcgctgatcggcaagatg
cccggcgacagatggcaaaagttcgccagcctgcgtgcgtatttcggctttatgtggacg
catccgggcaagaagctgctgttcatgggcggcgagttcgggcagttcgcggagttcaat
cacgacgaatcgccacactggcatttgctcgacgattccctgcatggcggcttgcagaaa
gccgtgcgcgatctgaatctgctttatacgagcgagcctgcattgcacaagctggatagc
gatgcgcgcggcttcgaatggatcgtcggcgatgacaacgccaacagcgtctacgcatat
cggcgcacggacgcggagggacgcgaactcgtcgtggtctgcaatatgacgccggtgccg
cggcttgcctaccggatcgggatgccgcgcggcggccgatggagcgaggtcttcaactcc
gatgcctcgatatatggcggatcgaacatgggtaatggcggcgtcattcatacggatgac
tatccgagtcatgggcgggggcagtcggctgctttgacgttgcctccgctcgcgaccatt
gttttacgcgctgattga

DBGET integrated database retrieval system