KEGG   Burkholderia sp. RPE64: BRPE64_BCDS12540Help
Entry
BRPE64_BCDS12540  CDS       T02684                                 

Gene name
malQ
Definition
glycoside hydrolase family 77
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
buo  Burkholderia sp. RPE64
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRPE64_BCDS12540 (malQ)
Enzymes [BR:buo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BRPE64_BCDS12540 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1280695..1282857
Genome map
AA seq 720 aa AA seqDB search
MSSIEALAERAGFEIEWKNAHKVMQRVPETTLRILLEKLGLPCGNATQIKQSMAAVDAEM
SGRKLPPLITAEVDRGIALPLSAAKSGTRYRIELESGAVIDGRFTSPKGEIALLSPIAEP
GYHTLVINDHRTTLAVAPARCYTIDDAWRTLDDDAPHAPPLWGVAAQVYGLRRNGDGGVG
DFTALAALATQTAKRGGHAIAISPMHAMFSAEPDKFSPYSPSSRLFLNIAHVDPAAVLGA
PALRAAIEKAGVAAELTELEGLTLIDWPRAMKARLAILRALFDTFSQDQASPLAKDFAAF
VEKGGRPLEDHARFEALQAAQIAENGGGHWRNWPDALRDPRSEEVAAFAQAHRREVDFYL
FAQWLAAKGLMHAQHAARDAGMAVGLVADLAVGCDSAGSHAWSYRDEMLTGVSVGAPPDL
FNQAGQSWGLTTFSPRAMRTQGFSAFIDMLRCAFARAGGIRIDHILGLRRLWLVPDGESA
ANGAYLRYPLEDLLRLIALESWRYRAIVVGEDLGTVPPGFTERLQEHGLLGIRVLWFERA
VDGPGFKPPHEWDGGVTATTTTHDLPTVTGWWRGEDIVLRSKIGQTMARDDGRDAVEVAL
EERGEDRELLWQAFQDAGIAPTDVDAPDIDNAPVDEALVFVAATPAPLVTYPLEDLLALT
DQPNLPGSIDEHPNWRRRMAQPVDELFLDDAFADRLLAVDTARKRSVQLNEHTSKPTESP
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatcgaggcgctcgcggaacgcgcgggcttcgaaatcgagtggaagaacgcg
cacaaggtcatgcagcgcgtgcccgaaacgacgctgcgcatcctgctcgaaaagctcggg
ctgccgtgcggcaacgccacgcagatcaagcagagcatggccgctgtcgatgccgaaatg
agcggccgcaaactgccgccgctgattaccgccgaagtggatcgcggcattgcgctgccg
ctgtcggcggcgaagtcgggtacgcgttatcgcatcgagctggaaagcggcgcggtgatc
gacgggcgcttcacgtcgcctaaaggcgagatcgcgttgctctcgccaatcgcggagccg
ggctatcacacgctcgtgatcaacgaccatcgcacgacgctcgcggtcgcgcccgcacgc
tgctacaccatcgacgatgcctggcgcacgctcgacgacgacgcgccgcatgcgccgccg
ctgtggggcgtcgccgcgcaagtctacggtctgcgacgcaacggcgacggcggcgtcggc
gacttcacggcgctcgccgcgctcgccacgcaaacggcgaagcgcggcggtcacgcgatc
gccatcagcccgatgcacgccatgttcagcgccgagccggacaagttcagcccgtactcg
ccgtcgtcgcggctgtttctcaacatcgcgcatgtcgatccggccgccgtgctgggcgcg
cccgctttgcgcgcggcaatcgaaaaggccggcgtcgccgctgaattgaccgaacttgaa
ggcctcacgctgatcgactggccgcgcgcgatgaaggcgcgtctcgcgattctgcgcgcg
ctgttcgatacgttttcgcaagatcaggcgtcgccgttggcgaaggatttcgctgcgttc
gtcgagaaaggcggacgaccgctcgaagatcatgcgcgcttcgaagccttgcaggcggcg
caaatcgcggaaaacggcggaggccattggcgcaactggcccgacgcgttgcgcgatcca
cgcagcgaagaagtggcggcgtttgcgcaggcacatcgccgcgaggtcgacttttatctc
ttcgcgcaatggctcgccgcgaagggactcatgcacgcgcagcacgccgcgcgcgatgcg
ggcatggcggtggggctcgtcgcggatctcgcggtcggatgcgatagcgcgggcagtcac
gcgtggtcgtatcgcgacgagatgttgacgggcgtctccgtcggcgcgccgcccgatctc
ttcaaccaggccgggcaatcgtggggcctcacgaccttctcgccacgcgcgatgcgcacg
caaggcttctccgcgttcatcgacatgctgcgttgcgcgttcgcgcgcgcgggcggcatc
cgcatcgatcacattctcggcttgcggcggctctggctcgtgcccgacggcgagagcgcg
gcaaacggcgcgtatctgcgctatccgctcgaagatctgctgcggctcatcgcgctcgaa
tcgtggcgatatcgcgcgatcgtggtcggcgaagatctcggcacggtgccgcccggcttt
acagaaagattgcaggagcacggcttgctcggcattcgggtgctgtggttcgagcgcgcc
gtggacggcccgggtttcaagccgccgcatgaatgggacggcggcgtcacggcgacgacg
accacgcacgatctgccgaccgtcaccggctggtggcgcggcgaggacatcgtgttgcgc
tcgaaaatcggccagacgatggcgcgcgacgatggccgcgacgcagtggaagtggcgctg
gaagaacgcggcgaggatcgcgagttgctgtggcaggcgtttcaggacgcgggcatcgca
cccacggacgtcgacgcgcccgacatcgacaacgcgcccgtcgatgaagcgctggttttc
gtcgccgcgacgcccgcgccgctcgtcacgtatccgctcgaagacctgctcgcgctgacg
gatcagccgaacctgccgggctcgatcgacgagcatccgaactggcggcggcgtatggcc
caacccgtcgacgagctgtttctcgacgatgcctttgccgatcgtctgctcgccgtggat
accgcgcgcaagcgctccgtgcaactgaacgaacacacttcgaaaccgacagaatcgcca
tga

DBGET integrated database retrieval system