KEGG   Burkholderia sp. RPE64: BRPE64_DCDS01780Help
Entry
BRPE64_DCDS01780  CDS       T02684                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
buo  Burkholderia sp. RPE64
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BRPE64_DCDS01780
Enzymes [BR:buo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BRPE64_DCDS01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:177083..177754
Genome map
AA seq 223 aa AA seqDB search
MNATDEDALRRAIVGTALEMERLGINQGTSGNVSARHGECFLITPSGVPARELDEMQIVR
LPLDIADDAAILGVERPSSEWRIHRDILRARADVHAVVHTHSIAATALAIHGREIPALHY
MVAAAGGKSIRCAPYAVFGSQQLSDHALAALDERHACLLAHHGVIALGTDLARAVWLAHE
VEVLAKQYLLALQIGAPPLLSDEQMDEVLEKFKTYGRRNKEHR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaccgatgaagacgcgttgcgccgcgcgatcgtcggcacggcgctcgagatg
gagcggctcggcatcaatcagggcacgtcgggaaacgtgagcgcgcgtcacggcgagtgc
tttctgatcacgccgagcggcgtgcccgcgcgcgaactcgacgagatgcagatcgtgcgg
ctgccgctcgatatcgccgacgatgccgcgatactgggcgtcgagcgcccgtcatccgaa
tggcgcattcatcgcgacattctgcgcgcacgcgccgatgttcacgcggtcgtgcatacg
cattcgattgcggccaccgcgctcgccattcatggccgcgagattcccgcgctgcattac
atggtcgcggcggcgggcggcaagtcgatacgctgcgcgccttatgccgtgttcggcagc
cagcagttgtcggatcacgcgctcgccgcgctcgacgagcggcacgcgtgtctgctcgcg
catcatggcgtgatcgcgctgggcaccgatctcgcgcgcgccgtatggctcgcccatgaa
gtggaagtgctcgcgaagcaatatctgctggcgttgcagatcggcgcaccgccgttgctt
tccgacgaacagatggatgaagtgctggagaagttcaagacttacggcaggcgcaacaag
gagcatcgctga

DBGET integrated database retrieval system