KEGG   Burkholderia sp. RPE64: BRPE64_DCDS03460Help
Entry
BRPE64_DCDS03460  CDS       T02684                                 

Definition
(GenBank) class II aldolase/adducin family protein
Organism
buo  Burkholderia sp. RPE64
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
p1:complement(361646..362359)
Genome map
AA seq 237 aa AA seqDB search
MNSTATIQTESHTGQKRMLADAILMLERAEVIDFNGHASWRVPGQERMLINSGASVRSAL
TAADIVIIDFDGNLIEGDAVPPMEFHIHSEIYRRRPDVGSVIHAHPLWSTLFSMTGKAVL
PVIMQAAVLGEIQRFPKTASINRKELGEELAEALGPHRVAMMKSHGSVIAASSILEAFVL
AFYLEENAHRQYLASQLGEPAVLDAEQIEAIRRNLWKPNLLQKVWDYHAGKLGARGD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaccgcaacgattcaaaccgaaagccacacgggccagaagcgcatgctggcc
gacgcgatcctcatgctggaacgcgccgaagtgatcgacttcaacgggcacgcaagctgg
cgcgtgcccggtcaggagcgcatgctgatcaactcgggggcatcggtgcgcagcgcgctg
actgcggccgatatcgtcatcatcgatttcgacggcaatctgatcgaaggcgatgccgtt
ccgccgatggagtttcacattcactcggagatctatcgcagacggccggatgtcggctcg
gtgattcatgcgcatccgctctggtccacgctcttcagcatgacaggcaaagccgtgctg
cccgtcatcatgcaagcagccgtgctcggcgagattcagcgtttccccaagaccgcttcg
atcaatcgcaaggaactcggcgaggaactggccgaggcactcgggccgcatcgcgtcgcc
atgatgaagtcgcatggctccgtgatcgcggcatcgagcattctcgaagcgttcgtgctc
gcgttctatctcgaagagaacgcgcatcggcagtatctcgcgagccagctcggcgagccc
gctgtgctcgatgccgaacagatcgaagcgatccggcgcaatctgtggaagcccaatctg
ctgcagaaggtctgggactatcacgcgggcaagctcggcgcgcgcggcgactga

DBGET integrated database retrieval system