KEGG   Burkholderia sp. RPE64: BRPE64_DCDS03630Help
Entry
BRPE64_DCDS03630  CDS       T02684                                 

Definition
putative class II aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
buo  Burkholderia sp. RPE64
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:buo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:379207..379920
Genome map
AA seq 237 aa AA seqDB search
MTLDEAKQKLIDAGRILEAEGQGDLTRGHISVRVPGDPTHFLMKPHSHGFDEITEDNIVV
CNLDGEKVSGGGRRHSEVFIHSEIFKVRPEVTSVIHAHPTHAVALSATGQPLEMISQPSV
HFADGLPYYTETMNLIRTQDMGAGVARALGQSKAVLMRNHGVAVAGRSIEESVVLSLLLD
NACRIQLLTKAAGGIGETFSAEDVNRLHDAVTRAEQFAVNFEFLRRKVNRNFVHSLV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgactctggacgaagcgaagcaaaaactgatcgacgccggccgtattctcgaagccgaa
ggccagggcgatctcacgcgcgggcacatctccgtgcgcgtgcccggcgacccgacgcac
ttcctgatgaagccgcacagccacggcttcgacgagatcaccgaggacaacatcgtcgtg
tgcaatctcgacggcgagaaggtgagcggcggcggccgccggcatagcgaggtcttcatt
cactcggagattttcaaggtgcgcccggaagtgacgagcgtgatccacgcgcatccgacc
cacgcggtcgcgctctccgcaaccggccagccgcttgagatgatcagtcagccgagcgtg
catttcgctgacgggctgccgtactacacggagacgatgaacctgatccgcacgcaggac
atgggcgcgggcgtggcgcgcgcgctcggacagagcaaggccgtgctgatgcgtaatcac
ggcgttgccgtggcaggacgctcgatcgaggaatccgttgtgctgtcgctccttctggat
aatgcatgccgtattcaattgctgacgaaggcggcgggcggcatcggcgagaccttctcg
gcggaagatgtgaaccgcctgcacgacgccgttacgcgcgcggagcagttcgccgtcaac
ttcgaattcctgcggcgcaaggtcaatcggaacttcgtgcattcgctggtttaa

DBGET integrated database retrieval system