KEGG   Burkholderia sp. RPE64: BRPE64_DCDS03630Help
Entry
BRPE64_DCDS03630  CDS       T02684                                 

Definition
(GenBank) putative class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00051  Fructose and mannose metabolism
buo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BRPE64_DCDS03630
Enzymes [BR:buo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BRPE64_DCDS03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAN27299
UniProt: R4WRW5
Position
p1:379207..379920
Genome map
AA seq 237 aa AA seqDB search
MTLDEAKQKLIDAGRILEAEGQGDLTRGHISVRVPGDPTHFLMKPHSHGFDEITEDNIVV
CNLDGEKVSGGGRRHSEVFIHSEIFKVRPEVTSVIHAHPTHAVALSATGQPLEMISQPSV
HFADGLPYYTETMNLIRTQDMGAGVARALGQSKAVLMRNHGVAVAGRSIEESVVLSLLLD
NACRIQLLTKAAGGIGETFSAEDVNRLHDAVTRAEQFAVNFEFLRRKVNRNFVHSLV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgactctggacgaagcgaagcaaaaactgatcgacgccggccgtattctcgaagccgaa
ggccagggcgatctcacgcgcgggcacatctccgtgcgcgtgcccggcgacccgacgcac
ttcctgatgaagccgcacagccacggcttcgacgagatcaccgaggacaacatcgtcgtg
tgcaatctcgacggcgagaaggtgagcggcggcggccgccggcatagcgaggtcttcatt
cactcggagattttcaaggtgcgcccggaagtgacgagcgtgatccacgcgcatccgacc
cacgcggtcgcgctctccgcaaccggccagccgcttgagatgatcagtcagccgagcgtg
catttcgctgacgggctgccgtactacacggagacgatgaacctgatccgcacgcaggac
atgggcgcgggcgtggcgcgcgcgctcggacagagcaaggccgtgctgatgcgtaatcac
ggcgttgccgtggcaggacgctcgatcgaggaatccgttgtgctgtcgctccttctggat
aatgcatgccgtattcaattgctgacgaaggcggcgggcggcatcggcgagaccttctcg
gcggaagatgtgaaccgcctgcacgacgccgttacgcgcgcggagcagttcgccgtcaac
ttcgaattcctgcggcgcaaggtcaatcggaacttcgtgcattcgctggtttaa

DBGET integrated database retrieval system