KEGG   Burkholderia sp. RPE64: BRPE64_DCDS05680Help
Entry
BRPE64_DCDS05680  CDS       T02684                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
buo  Burkholderia sp. RPE64
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BRPE64_DCDS05680
Enzymes [BR:buo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BRPE64_DCDS05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:591634..592566
Genome map
AA seq 310 aa AA seqDB search
MKSVVILGIYVTDLAFRAQRMPLLGETVAGSAFKMGPGGKGSNQAVAAARAGANVIFCTR
IGADAFGEIAQATWDAEGITSRATVMNDVATGAAHIYVDENTGGNAIIVAAGAAGTLVPE
DVEAIEADIASAGVFVTQLEQPIPAARRGLELARKHGVTTVFNPAPALPLTDDIYPLCDY
ITPNETEATALTGIEIAHVDDARRAADVLLAKGARAVIVTLGEAGALLHTANESTLVPAF
DCGRVVETAGAGDGFTGGFAAALARGDSPLDAVRFGCALASLSVTRPGTAPSMPRLDEIN
AVLADRSVTQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtcgtcattctcggcatctatgtcaccgatctcgcgtttcgcgcgcaacgc
atgcctttgctcggcgagactgtcgcgggctccgcgttcaagatgggaccgggcggcaaa
ggttcgaatcaggcggtggccgccgcgcgcgcgggtgcgaacgtgatcttctgcacgcgc
atcggcgccgatgcattcggcgagatcgcgcaggcaacgtgggacgccgaaggcatcacg
tcgcgcgcaaccgtcatgaacgacgtcgcgacgggcgccgcgcatatctatgtggacgag
aacacgggcggcaacgcgatcatcgtcgcggcgggcgcggcgggcacgctcgtgcctgag
gacgtcgaggcgatcgaggccgacatcgcgagcgcgggcgtattcgtcacgcaactggag
cagccgattccggctgcgcgccgtggactcgaactcgcgcgcaagcatggcgtgaccacg
gtcttcaatcccgcgcccgcgttgccattgacggacgacatctatccgctgtgcgactac
atcacgccgaacgaaacggaagcgaccgcgttgacgggcatcgagatcgcccatgtcgat
gatgcacgccgcgccgccgacgtattgctcgcgaagggcgcacgcgcggtcatcgtcacg
ctcggcgaagcgggtgcgctcttgcatacggcgaacgaatcgacgcttgtgcctgcgttc
gattgcggccgcgtggtcgagaccgcaggcgcgggcgacggcttcaccggcggtttcgcg
gcggcgctcgcacgcggcgacagcccgctcgatgccgtgcgcttcggttgcgcgctcgcg
agcctttcggtgacgcgcccgggcaccgcgccgtcgatgccgcgtctcgatgaaatcaac
gcggtgctggcggacaggagcgtgacacaatga

DBGET integrated database retrieval system