KEGG   Burkholderia sp. RPE64: BRPE64_ECDS03050Help
Entry
BRPE64_ECDS03050  CDS       T02684                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buo  Burkholderia sp. RPE64
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRPE64_ECDS03050
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_ECDS03050
   00640 Propanoate metabolism
    BRPE64_ECDS03050
   00650 Butanoate metabolism
    BRPE64_ECDS03050
  Lipid metabolism
   00071 Fatty acid degradation
    BRPE64_ECDS03050
   00072 Synthesis and degradation of ketone bodies
    BRPE64_ECDS03050
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRPE64_ECDS03050
   00310 Lysine degradation
    BRPE64_ECDS03050
   00380 Tryptophan metabolism
    BRPE64_ECDS03050
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRPE64_ECDS03050
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRPE64_ECDS03050
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRPE64_ECDS03050
Enzymes [BR:buo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRPE64_ECDS03050
Exosome [BR:buo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRPE64_ECDS03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
p2:289345..290529
Genome map
AA seq 394 aa AA seqDB search
MNVREIVIAHPVRTPIGAFGGSLKDVPAVQLGATVIRETLKRAALDPSSVASVVMGNVIQ
AGNKMNPARQASIGGGLPVSVPALTVNRVCGSGAQAIVSAAHEIALGFGDVAVAGGMENM
DRAPYLLPSGRWGQRMGNAEIFDSVMRDGLGDAFSDKASGWHTEDLVKEAGLTRADLDEW
AARSQQRFAAARERGLFDAELVAVEVPGKKGPIEFVRDEQPRPETSVETLSKLRPAFRPD
GAITAGNAPGINTGASAMLVAGRDYAEQHGIEASARLAGFGVAAVEPGMFGLGPVPAVPI
ALQRAGWQLSDIERIEINEAFAAVPLAIAKKLGLPHDMINVEGGAVAHGHPIGATGAVLV
TRLIHSMRRDGLKRGVVTLCIGGGQGIALALEML
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacgtgaaatagtcatcgcgcatccggtccgaacgcctatcggcgcttttggc
ggctcgctcaaggatgttccggccgttcagctcggtgcgaccgtcatacgcgaaacactg
aagcgtgctgcgctcgatccgtcgagcgtcgcatcggtggtgatgggcaatgtcatccag
gctgggaacaagatgaatccggcgcggcaggcgtcgattggcggcggccttccggtgtcg
gttccggcattgacggtgaatcgcgtctgcggatcgggcgcccaggcgatcgtttccgcg
gctcatgaaattgcgctgggattcggcgacgttgcggtcgcgggcggcatggagaacatg
gaccgtgcgccctacttgcttccgagcggccgttggggccagagaatgggcaacgcggag
atcttcgacagcgtgatgcgcgacggtctcggtgatgccttctcggataaggcgtctggc
tggcacaccgaagacctcgtgaaagaggcagggctgacgcgggccgatctcgacgagtgg
gcggcccgctcccagcagcgattcgccgctgcgcgtgaacggggtctgttcgacgcggag
ttggttgcagtcgaagttcccggcaagaaagggccgatcgagtttgtgcgcgatgagcaa
ccgcggccggagacgtctgtcgagacgctctcgaaacttcgcccggccttccgtccggac
ggcgccatcacggcagggaatgctcccggtatcaataccggcgcgtcggcaatgctcgtt
gcaggtcgggactacgccgagcagcacggtatcgaggccagtgcgaggctggccggattc
ggcgtcgcggccgtcgagcccggtatgttcggcctgggaccggtgccggccgttccgatc
gcgctccagcgcgcaggctggcaactgagcgacatcgaacgaatcgagatcaacgaggca
tttgccgcggtgccgctcgcaatcgcgaagaaacttggactgccgcacgacatgatcaat
gtggagggaggagcggtcgctcacggccacccgatcggcgcgaccggtgcggtccttgtc
acgcgtctgattcattcgatgcggcgggacggcctcaagcgcggcgtggtcacgctttgc
atcggcggcggtcaaggcatcgcgctcgccttggagatgctttga

DBGET integrated database retrieval system