KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_00765Help
Entry
CWQ_00765         CDS       T01829                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CWQ_00765
   00670 One carbon pool by folate
    CWQ_00765
Enzymes [BR:bup01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CWQ_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149152..149637)
Genome map
AA seq 161 aa AA seqDB search
MNISLIAAISKNLVIGYKNKIPWYLPEDLKWFKQKTINKNIIMGRLTWESIKKKPLPMRK
NIVISSNEIKQEGIIWADSISNAIISAQYNQEIMIIGGAKIYKEMLFYANKLYLTHIDID
IVGDAYFPEYKLYPYWKTLFRKKNTKNKMNPYNYSFEILSR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatataagtttaattgctgctatatctaaaaatttagttatcggatataaaaataaa
ataccttggtatcttccagaagatttaaaatggtttaaacaaaaaacgattaataaaaac
ataattatgggtcgattaacttgggagtctattaaaaaaaaacccttaccaatgcgtaaa
aacatagttattagtagcaatgaaatcaaacaagagggtattatttgggctgattcaata
tctaatgcaattatatctgcacaatacaatcaagaaattatgattattggtggtgctaaa
atatataaagaaatgctattttatgctaataaattatatttaactcatatagatattgat
attgttggtgatgcttattttcctgaatataagttatatccatattggaaaacattattt
agaaaaaaaaataccaaaaataaaatgaatccatacaattattcatttgaaattttatca
agataa

DBGET integrated database retrieval system