KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_01030Help
Entry
CWQ_01030         CDS       T01829                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
bup00260  Glycine, serine and threonine metabolism
bup00750  Vitamin B6 metabolism
bup01100  Metabolic pathways
bup01110  Biosynthesis of secondary metabolites
bup01120  Microbial metabolism in diverse environments
bup01230  Biosynthesis of amino acids
Module
bup_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWQ_01030
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CWQ_01030
Enzymes [BR:bup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CWQ_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N SAGA-Tad1 PRMT5_C
Motif
Other DBs
NCBI-ProteinID: ADP66587
Position
complement(207006..208295)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKNHNEQVNFEAAVKLGLGQQQGLFFPVELPTITPIELSKILKMDFITRSTEILS
KFICHEISKEELYKHVKQAFSFKHPLKIKITKDIHCFELFHGPTLAFKDFGARFMAQMIL
LLNKKNESVTILTATSGDTGAAVANAFYGMKNVRVIILYPKGKISELQEKLFCTLGRNIK
TISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLLAQICYYFEAFSLISEEQR
KNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTVPRFLNNGTWNPKKTVSTIS
NAMDISQPNNWTRIEELFYRKKWDLKKLRFGSVSDHTTEETLKELFKLGYVSEPHAAIAY
RLLRDQLKENEFGLFLGTAHPAKFKNTVEKILKNKISLPSELQNRIDLPLLSHNINPVFS
KLKTFLLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacaatttaaaaaaccataacgaacaagtaaattttgaagcagccgtaaaa
ttaggattaggtcagcaacaagggttgtttttccctgtagaattacctactattactcct
attgaattatcaaaaatattaaaaatggattttattactcgcagtactgaaatactttct
aaattcatttgtcatgaaatatctaaagaagaactatataaacatgttaaacaagcattt
tcatttaaacatccattaaaaataaaaattacaaaagatatacattgcttcgaactgttt
cacggtccaacattggcgtttaaagattttggagctcgttttatggctcaaatgatatta
ttactaaataaaaaaaatgaatcagttactattttaactgcaacatcaggtgatacaggt
gcagcggtagcaaatgcattctatggaatgaaaaatgtgcgagtaattattttatatcct
aaaggcaagatcagtgaattacaagagaaattattttgtactttaggtagaaatataaaa
actatatcaattaatggtagttttgacgattgtcaaaaattagtaaaagaagcttttaac
gataaaaaactgaaagaatcaataggattaaattcagctaattcaattaatataagtaga
ttattagcacaaatctgttattattttgaagctttctctttaatttcagaagaacaaaga
aaaaatttagtaatagcagttccatgcggtaattttggaaatttaacagctggattatta
tctaaatctcttggtttgccaatcaaatcatttatagcatgtacgaatgcgaatgatacc
gtaccaagattccttaataatggcacgtggaatcctaaaaaaactgtatctacaatttct
aatgctatggatatcagtcaacctaataattggactcgaattgaagaattattttatcga
aaaaaatgggatttaaaaaaacttaggtttggaagtgtatcggatcatactacagaagaa
acattaaaagaactatttaaattaggttatgtttctgaacctcatgcagcaatagcatat
agattgttgcgagatcaattaaaagaaaatgaatttggcttatttttaggcaccgctcat
ccggctaaatttaaaaatactgtagaaaaaatattaaaaaataaaatttcactgccttct
gaactacaaaatagaattgatttaccattattatctcataatattaaccctgtttttagt
aaattaaaaacgtttttattagaaaaataa

DBGET integrated database retrieval system