KEGG   Buchnera aphidicola TLW03: CWQ_01195Help
Entry
CWQ_01195         CDS       T01829                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bup  Buchnera aphidicola TLW03
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bup00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bup00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(243724..245220)
Genome map
AA seq 498 aa AA seqDB search
MNKICLKYLLLPWIKNIPKKYISNLKMDSRTLTPGDLFIAVPGIKKDGRHFIVQAINKKA
VAILCETKKKDKHGIFKYIKNVILIYFFKLSENVSLLANRFYKEPGKRLKIIGITGTNGK
TTVTQLINQWSTILGTKTATMGTLGNGFYNSLQPTNNTTSSPIFIQLFLSKVLEKQAELV
TMEVSSHGLIQHRVKEVPFYIAIFTNLTQDHLDYHENMEKYESAKWLLFSTHKVKKIILN
ADDQYGKIWLKKLLNFYTVAVTIQNRKQKKYSTKWINATNIEQNNNNSIYITFESSWGTG
RISSCLIGRFNVTNLLLSLACLLELGYSLSDLIHTSEKIIPVQGRMELFSYVKKPTFIID
YAHTPDALKKTLNAIHSHYQRYIWCIFGCGGERDQKKRPIMGAIAEKMSDKVIITNDNPR
NEKEKKIIQDILNGCKNKEKILIIPDRKKAISYAYFGAKYHHIILIAGKGHEEKQIIQNR
SINYSDKKIVLNLLGKNI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatttgcttaaaatatttattattaccatggattaaaaatattccaaaaaaa
tatatttcaaatttgaagatggatagcagaactttaactccaggagatttgtttatagca
gttccggggataaaaaaagatggccgtcatttcattgttcaagctattaataaaaaagca
gtagccattctatgtgaaactaaaaaaaaagataagcatggaatatttaaatatatcaag
aatgttattctaatatacttttttaaactatctgaaaatgtatcattgttagcaaatcgt
ttttataaagaaccaggaaagagattaaaaatcatcggcataactggtactaatggaaaa
actacggtaacacaattaatcaatcagtggagtacaattttaggtacaaaaacagcaact
atgggaactttaggaaatggtttttataattctttgcaacctacaaataatacaacttcc
tcgcctatttttattcaactattcttatctaaagtcttagaaaaacaagctgaattagtg
actatggaagtttcttcacatggtttgatacaacatcgcgttaaagaagttcctttttat
attgcaattttcactaatctaactcaagatcacttagattatcatgaaaatatggaaaaa
tatgaatcagcaaaatggttattatttagtacacataaggtaaaaaaaattatattaaat
gctgatgatcaatatgggaaaatatggttaaaaaaactacttaatttctacacagtagct
gttactattcaaaacagaaaacaaaaaaaatattctacaaaatggattaacgccactaat
attgaacagaataataataattccatttatattacatttgaatctagttggggaacagga
agaatatcctcttgtttaattggacgttttaatgtgactaatctcctgttgtcattagct
tgtcttttagaactaggctatagtttatcagacttaatccatacgtctgaaaaaataata
ccagtacagggtcgaatggaattattttcttatgtcaaaaaaccaacttttattatcgat
tacgctcatacacctgatgcactaaaaaaaacacttaatgccattcattcacattaccaa
agatatatatggtgtatatttggatgtggaggagaaagagatcaaaaaaaacgccctatt
atgggtgctattgcagaaaaaatgtcagataaagtgatcattactaatgacaaccccaga
aatgaaaaagaaaaaaaaattattcaagatattttaaatggttgtaaaaataaggaaaaa
atattaattatccctgatagaaaaaaagcaatatcttatgcttatttcggagcaaaatat
catcatataattttaatagctggaaaaggacacgaagaaaaacaaataattcaaaataga
tctataaactattcagataaaaaaatagtattaaatttattaggaaaaaatatatga

DBGET integrated database retrieval system