KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_01480Help
Entry
CWQ_01480         CDS       T01829                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CWQ_01480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWQ_01480
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CWQ_01480
Enzymes [BR:bup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CWQ_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303843..305054)
Genome map
AA seq 403 aa AA seqDB search
MTLLNPYFGEFGGMYVPQILMPALFELEENFVSAQKDAEFQKKFFYLLQNYAGRPTPLTL
CKNLTKGTKTKIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKEIIAETGAGQHGVASAI
ACALFNLKCRIYMGIKDIKRQNTNVFRMKLMGAEVISVKNGSGTLKDACNEALRDWSSSY
KKSHYMIGTAAGPHPYPTIVREFQKMIGEETKKQILEKENTLPDSIIACIGGGSNAIGIF
SDFINDKVNLIGVEPAGYGIHTGKHGAPLKHGRTGIYFGMKSHLMQNKQGQIQESWSISA
GLDFPSVGPEHAWLNSINRAKYVSITDEEAISAFQVLSRKEGIIPALESSHALAYALKLM
KKDPKKEQILIVNLSGRGDKDIFTVHDVLKKKESNHESISGNI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactttactaaatccttattttggtgagtttggcggtatgtacgttccacaaatatta
atgccagctttatttgaattggaagaaaattttgtttccgcgcaaaaagatgctgaattt
caaaaaaaatttttttatttattacaaaactatgctggcagacctactccattaactcta
tgtaaaaatttaaccaaaggaacaaaaacaaaaatttatcttaaaagagaggatttacta
catggtggagcacataaaactaatcaagtattaggtcaagctatgttagcaattagaatg
aaaaagaaagaaattattgctgaaacaggtgctggacaacatggtgtagcttctgcaatt
gcttgtgcactatttaatttaaaatgtagaatttacatgggaattaaagatattaaaaga
caaaacacaaatgtgtttcgtatgaaattaatgggtgcagaagtcatctcagttaaaaac
ggttctggaacactaaaagacgcatgtaatgaagctttacgcgattggtctagtagttat
aaaaaatctcattatatgattggtactgcagctggaccacatccctatcccactattgtt
cgtgaatttcaaaagatgattggggaagaaacaaaaaaacaaattttagaaaaagaaaac
acacttcctgattcaattattgcatgtattggcggtggatctaatgctattggtatattt
tcagattttattaatgataaagttaatttaatcggagtagaaccggctggttatgggata
cacacaggaaaacatggggcaccattaaaacatggtagaaccggtatttattttggtatg
aaatcacatttgatgcaaaataaacagggtcagattcaagaatcttggtcaatttcagca
ggattagattttccatctgttggtcctgaacatgcttggttgaatagtattaaccgtgcg
aaatatgtctctattactgatgaggaagcaataagtgcatttcaggttttatctcgaaaa
gaaggcattattcctgctttagaatcttctcatgcattagcatatgcattaaaattaatg
aaaaaagatcctaaaaaagaacaaattttaattgttaatctttctggtcgtggagataaa
gatatttttacagtacatgatgttttaaaaaagaaggagagtaatcatgaatcgatatca
ggaaacatttaa

DBGET integrated database retrieval system