KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_01620Help
Entry
CWQ_01620         CDS       T01829                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
bup00010  Glycolysis / Gluconeogenesis
bup00260  Glycine, serine and threonine metabolism
bup00680  Methane metabolism
bup01100  Metabolic pathways
bup01110  Biosynthesis of secondary metabolites
bup01120  Microbial metabolism in diverse environments
bup01130  Biosynthesis of antibiotics
bup01200  Carbon metabolism
bup01230  Biosynthesis of amino acids
Module
bup_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWQ_01620 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CWQ_01620 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWQ_01620 (gpmA)
Enzymes [BR:bup01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CWQ_01620 (gpmA)
Membrane trafficking [BR:bup04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CWQ_01620 (gpmA)
Exosome [BR:bup04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CWQ_01620 (gpmA)
  Exosomal proteins of melanoma cells
   CWQ_01620 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADP66695
Position
338357..339052
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIIYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgccgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaaggcttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattatttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttagatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system