KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_01635Help
Entry
CWQ_01635         CDS       T01829                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CWQ_01635 (tpiA)
   01230 Biosynthesis of amino acids
    CWQ_01635 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWQ_01635 (tpiA)
   00051 Fructose and mannose metabolism
    CWQ_01635 (tpiA)
   00562 Inositol phosphate metabolism
    CWQ_01635 (tpiA)
Enzymes [BR:bup01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CWQ_01635 (tpiA)
Exosome [BR:bup04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CWQ_01635 (tpiA)
  Exosomal proteins of bladder cancer cells
   CWQ_01635 (tpiA)
  Exosomal proteins of melanoma cells
   CWQ_01635 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341064..341831)
Genome map
AA seq 255 aa AA seqDB search
MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPTIYLERVCKNISNMNI
FLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHHETDDIIAKKFHLIKKS
NLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNLGTSAFKNIIIAYEPIWAIGTGVSAD
PEHVQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSA
KEFLEIIKIAHEHYS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcttcattacagctaactggaaattaaatggaaatataaaaatgatttct
agttttttcaaatatttaaaattatattcatcaagttatttagaaaaaaacactgttatt
attgctcctccaactatatatttagaacgagtatgtaaaaatataagcaatatgaacatt
tttcttggttcgcaaaacgtagatattaatttaaacggagcatttaccggtgaaacttct
attttgatgctgcgagatataggagtaaaatatgtgattatagggcattccgaaagacgt
tttttacatcatgaaactgatgatatcattgcaaaaaaatttcatttaattaaaaaatca
aatttaacacctatattgtgtgtaggtgaaacagaaatagaaaaaaaacataatcaaacc
gagcaggttattcaaagacaattaaatttgatattaaaaaatttaggcacatcagcattt
aaaaatataataattgcctatgaacctatttgggccatcggaactggtgtatcagcagat
ccagaacatgttcaactaatacatgtatttataaaaaattatattttaaaatatagctca
atcaatagaaatgatataataattcaatacggtggatctattaatcatactaatgtaaaa
aagtttattgaacaaccagacatcaatggtttattaattggaaattcatctttaagtgct
aaagaatttttagaaattataaaaatagcacacgaacactattcataa

DBGET integrated database retrieval system