KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_02450Help
Entry
CWQ_02450         CDS       T01829                                 

Definition
exodeoxyribonuclease V 67 kDa polypeptide
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bup00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CWQ_02450
Enzymes [BR:bup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CWQ_02450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501742..503514
Genome map
AA seq 590 aa AA seqDB search
MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACISYESSRGYISLPIKYFEKHYF
FSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLHKKKIYLYKMWKSESNI
FNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLINNITFIIGGPGTGKTTT
ILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDLYFSEKEKCSLPSAATTIH
QLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKILSSISKNTKLIFIGDHNQL
GPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKINKKTTNFISDNICVLNKNYR
FNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETNSSEQYKKMIKNICLNYEDFWE
KIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKLEENMYKKNIIKYFYIDGEEWYI
GKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLKENNTINNIPVKILRNYKTAWAIT
VHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRSRKILSIFSDKKNFF
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcttattttattaaaaaaagctgtaaaattgaaaattatacgtccaattgatttttat
ttttctcaatttatcgcacaaaaaaataatattgttatgttagttgctgcttgtataagt
tatgaaagcagtagaggttatatttctctgccaattaaatattttgaaaaacattatttt
ttttctagttcaaatgaagtatttataaaaaaaatattgactcttttagaaaaaaaaata
aattggcccgttgagttattaaaacatgcatctattggtaatggtggtacttctacacct
ttagttttacataaaaaaaaaatatatctctataaaatgtggaaatctgaaagtaatatt
tttaactatttatatacaaaaaataaaaaaaataaaattaatcaaaaaaaatgctcaaaa
atattggaaaatttgtttcctcaaaaaaatatgagttttcagaaaatagcagtagcatta
actttaataaataatataacatttattattggtgggcccggaactggaaaaactactact
atattgaaaataataattgcattaataaaaagttcaaaaaaatcaataaaaattcagtta
tctgcaccgacaggaaaagcgacaacacatttaaatgaaattctaaaaaacaatatcttt
gatctgtatttttctgaaaaagaaaagtgttctctaccatctgcagctacaactatacat
caactattgggtattcaaaaaatatcacaaaaaagtttttttaataaaagtaactgctta
gatttagatgttttgattatcgatgaaatctcaatggtagacattttaatgatggaaaaa
atattatcttcaatttcaaaaaataccaagttaatttttataggagatcataatcaatta
ggtccaatagaatcaggttctattctaagaaaaatttgttattacgcaaatgatggatat
agctttaaatctatgattagtattgaaaaacttacacaatataaattgtgtaaaaaaata
aataaaaaaacaacaaactttattagtgataatatatgtgttttaaataaaaactacaga
tttaataaaaattcaggtatttatacgttgtctaatgctatttttaagaaaaaaactagg
atcattgaaagtctatttgataattcgataaaaaacatttttttttatgaaactaactct
tctgaacaatataaaaaaatgatcaaaaatatatgtttaaactatgaagatttttgggaa
aaaatatataaaaaagcgacaatgaaagaaataatagaatcttttcaaaattatcaagtt
ttgtgcatattgcatgatggtttatttggtgtgaatattataaataaaaagttagaagaa
aatatgtataaaaaaaatattataaaatatttttatattgatggagaagaatggtatata
gggaaacctattatgattattaataataatcgtgctctcaatgtatcaaatggaaatata
ggtattactaacatcaataaaaatggcattttacaagtatcttttttaaaagaaaacaat
acaattaataatattcctgtaaagatattaagaaattataaaactgcctgggctattact
gttcataaatcacaaggttcagaatttatgaatacagctttaatactacctaatttcaac
tctcatattttaaataaagacactttgtatactggtataacaagatctcgaaaaatatta
agtattttttcagataaaaaaaattttttttaa

DBGET integrated database retrieval system