KEGG   Buchnera aphidicola TLW03: CWQ_02980Help
Entry
CWQ_02980         CDS       T01829                                 

Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CWQ_02980
Enzymes [BR:bup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CWQ_02980
Transfer RNA biogenesis [BR:bup03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CWQ_02980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(594480..595277)
Genome map
AA seq 265 aa AA seqDB search
MQKINFFDTINNIWRKMLDKICQLARSAGHCIMKLYNSQKFINVSYKPDNTPITDVDYAA
NNIIKKGLSLISPQIPIISEEESYNFEICRNWNSYWLVDPLDGTKEFLKKNGEFTVNISL
IEYGVPILGVIYAPFFDVLYSAFYDNAWKEEKFGSKKKINVAQAEAPLLVISRSHPNETL
KNYLEKIKCCKIKKMGSSLKFCLIAEGTAQIYPRFGDTHIWDTAAGHAIVIAAGGKVQTW
TGGNLNYSLSSRVSFINSGFYASAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaattaatttttttgatactattaataatatatggcgtaaaatgttagataaa
atttgtcaattagcacgttctgcaggtcattgtattatgaaactttataattctcaaaaa
tttataaatgtttcatataaaccagataacactcccatcaccgatgttgattatgcagcc
aataatatcatcaaaaaaggactttcattaatttctcctcaaattccaattatttctgaa
gaagaatcatataattttgaaatatgtcgtaattggaatagttattggttagttgatccg
ttagatggaactaaagaatttttaaaaaaaaatggtgaatttacagttaatattagttta
atcgaatacggtgtccctatacttggtgtaatatacgctcccttttttgatgttctatat
tctgctttttatgacaatgcatggaaagaagaaaaatttggatcaaagaaaaagattaat
gttgctcaagcagaagcaccattattggtgattagccgttcacatcctaatgaaaccttg
aaaaattatttagaaaaaataaaatgttgtaaaataaaaaaaatgggttcatcactaaaa
ttttgcttaatagcagaaggaactgctcaaatttatcccagatttggtgatactcatata
tgggatactgccgctggtcatgctattgttatagcggctggtggaaaagtacaaacatgg
acaggcggcaatttaaattattcattgtcttcacgtgtttcttttattaattctggtttt
tatgcgtccgcattataa

DBGET integrated database retrieval system