KEGG   Buchnera aphidicola TLW03: CWQ_03150Help
Entry
CWQ_03150         CDS       T01829                                 

Definition
uroporphyrinogen-III synthase, putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bup  Buchnera aphidicola TLW03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bup00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CWQ_03150
Enzymes [BR:bup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CWQ_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626409..626822
Genome map
AA seq 137 aa AA seqDB search
MKIINKDKIKNNRIILLQGENGRKLIKRRLEKEGFKICLIECYKRVFKILDTNMEVKKWR
SYKIDTLVVTNSESLHQLKNIISSTNQIQWLFGCRIFVVGKRLFRIAKKLGWNDVIVSKY
ANNDSFIKKIKETNFKN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataatcaataaagacaaaataaaaaataatagaataattttattacaaggggaa
aatggacgaaaattaataaaaagaagattagaaaaagaaggatttaaaatttgtctaatt
gaatgttataaaagagtcttcaaaattttagatactaatatggaggtaaaaaaatggcgt
tcatataaaatagatactttagtagtaacaaatagcgaatctttacatcagttaaaaaat
attatttctagtactaatcagattcaatggttattcggatgcaggatttttgttgtcggt
aaaagattgtttcgtatagcaaaaaaattaggatggaatgatgtaatagtttcaaaatat
gctaataatgattcttttatcaaaaaaataaaagaaacgaattttaaaaattaa

DBGET integrated database retrieval system