KEGG   Burkholderia lata: Bcep18194_A3212Help
Entry
Bcep18194_A3212   CDS       T00286                                 

Definition
type III restriction enzyme, res subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bur  Burkholderia lata
Brite
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Bcep18194_A3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(41836..44862)
Genome map
AA seq 1008 aa AA seqDB search
MRLHFEADLDYQREAIDAVCDLFRGQESYRGDFSVLANAAPGTTAAAQGSLGFAVSEQGV
GNRLSLTDDALARNLADVQLRGGLPPSGLPGSRDFTVEMETGTGKTYVYLRTIFELNRRY
GFTKFVIVVPSIAIKEGVHKTLAITEDHFRALYAGVPYDYFLYDSAKLGQVRHFAASAAI
QIMVMTVAAINKKEINNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLEGRGREA
LAAMAPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIEIASAIVEDAHNKPYVRLVG
VSNRRGAISARVELDVATTAGVKRQIVTATDGDDLERLTKRALYAGLRIGEVHAVKGAEY
VELRHPEGEAFLSLGEAFGDIDTLAVQREMIRRTIREHLDKELRLAERGVKVLSLFFVDS
VERYRQYDENGMPVKGDYALIFEEEYARAARVPAYRALFDGVDVALEVGRAHNGYFSIDR
KGGWTDTSESSAAARENAERAYGLIMREKEALLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIQTERERRQTLGRGLRLAVDQDGERVRDAGVNTLTVIATERYESFAENLQKEIEA
DTGIRFGIVEEHQFAALPVQEGDGPAHALGVELSRVLWNHLHEQGYVDAQGKVLDRLKDA
LRQSALVLPEAFEMLRAPIVATLRKLSGRFAVRNADERRAIALRRDASGKAVVFGEEFRA
LWDRIRHRTVYRVEFDNAKLVRDCAAALHDAPDIARARLQWRKAEIDIGKAGIEAIEVAG
AGTVLLDEGELPLPDLLTELQDRTQLTRRSLATILADSGRLEDFRVNPQQFITVAADAIN
RCKRLALVAGIAYRKLGERHVHALESFESEALTGYLRNLRPDAQKSIHEAVVCETDAERA
FADALEAHDGVKLYAKLPAWFRVQTPLGSYHPDWAVLAEQDGGERLYFVVDTPNADGNVP
SEHERAKLACGEAHFRALVDGDGAARFVRVRQADALFEPAVPLVGTGR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcatttcgaagcggatctcgactaccagcgcgaggcgatcgacgccgtctgc
gacctgtttcgcggccaggaatcgtatcgcggcgacttcagcgtgctcgcgaacgccgcg
cccggcaccacggccgccgcgcaaggctcgctcggcttcgcggtgtcggaacagggcgtg
ggcaaccggctgtcgctgaccgacgacgcgctcgcgcgcaatctcgccgacgtgcagctg
cgcggcgggctgccgccgtccgggctgcccggctcgcgcgacttcaccgtcgagatggaa
accggcaccggcaagacctacgtgtacctgcgcacgatcttcgagctgaaccgccgctac
ggcttcacgaagttcgtgatcgtcgtgccgtcgatcgcgatcaaggaaggcgtgcacaag
acgctcgcgatcaccgaggatcacttccgcgcgctgtacgcgggcgtgccgtacgactac
ttcctgtacgactcagcgaagctcggccaggtgcgccacttcgcggcgagcgcggcgatc
cagatcatggtgatgacggtcgcggcgatcaacaagaaggaaatcaacaacctctacaag
gacagcgagaagaccggcggcgagaagccgatcgacctgatccgcgcgacgcgtccgatc
gtgatcgtcgacgagccgcagagcgtcgacggcgggctcgaaggccgcggccgcgaagcg
ctcgccgcgatggcgccgctctgcacgctgcgctattcggccacgcacgtcgaccgtcac
cacatggtgtaccggctcgacgcggtcgacgcgtacgagcgcaagctggtcaagcagatc
gagatcgcatcggcgatcgtcgaggatgcgcacaacaagccttacgtgcggctcgtcggc
gtgtcgaaccggcgcggcgcgatcagcgcgcgcgtcgagctcgacgtcgcgacgacggcc
ggcgtgaagcgccagatcgtgaccgccaccgacggcgacgatctcgaacgcctgaccaag
cgcgcgctgtacgcggggctgcggatcggcgaagtccatgcggtgaagggcgccgaatac
gtcgagctgcgccatccggaaggcgaggcgttcctgtcgctcggcgaagcgttcggcgac
atcgacacgctcgccgtgcagcgcgagatgatccgccgcacgatccgcgagcatctggac
aaggagctgcgcctggccgaacgcggcgtgaaggtgctgtcgttgttcttcgtcgattcg
gtcgagcgctatcgccagtacgacgagaacggcatgccggtgaagggcgactacgcgttg
atcttcgaagaggaatatgcgcgtgcggcacgtgtgccggcctaccgtgcgctgttcgac
ggtgtcgacgtcgcgctcgaagtcgggcgcgcgcacaacggctacttctcaatcgaccgc
aagggcggctggaccgacacgagcgaaagcagcgccgcggcgcgcgaaaacgcggagcgt
gcgtacggcctgatcatgcgcgagaaggaagcgctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaacccgaacgtgttccagatc
tgcacgctgcgcgacatccagaccgaacgcgagcgccgccagacgctcggccgcgggctg
cgcctcgccgtcgaccaggacggcgaacgcgtgcgcgatgcgggcgtgaacacgctcacc
gtgatcgcgaccgagcgctacgagtcgttcgcggagaacctgcagaaggaaatcgaggcc
gatacgggcatccggttcggcatcgtcgaggagcaccagttcgcggcgctgcccgtgcag
gaaggcgacgggcccgcgcatgcgctcggcgtcgagctgtcgcgcgtgctgtggaatcac
ctgcacgagcaaggctacgtcgacgcgcagggcaaggtgctcgaccggttgaaggatgcg
ctgcgccagagcgcgctggtgctgccggaggcgttcgagatgctgcgcgcgccgatcgtc
gcgacgctgcgcaagctgtcgggccgctttgcggttcgcaatgcggacgagcgccgtgcg
atcgcgctgcgacgcgacgcatcgggcaaggccgtcgtgttcggcgaggagttccgcgcg
ctgtgggaccgcatccgccatcgcaccgtgtaccgcgtcgagttcgacaacgcgaagctc
gtgcgagactgcgcggctgcgctgcacgacgcgccggacatcgcacgcgcacggctgcag
tggcgcaaggccgagatcgacatcggcaaggccggcatcgaggcgatcgaggtggccggc
gccggcacggtgctgctcgacgaaggcgagctgccgctgcccgacctgctcaccgagctg
caggaccgcacgcagctcacgcgccgttcgctcgcgacgatcctggccgacagcggccgg
ctcgaggatttccgcgtgaatccgcagcagttcatcacggttgcggccgatgcgatcaac
cgctgcaagcggctcgcgctcgtcgcgggcatcgcgtaccgcaagctcggcgagcgccat
gtgcatgcgctcgaatcgttcgagagcgaggcgctgaccggctatctgcgcaacctgcgg
cccgatgcgcagaagtcgatccacgaggcggtcgtgtgcgagacggacgcggaacgcgcg
ttcgccgatgcgctcgaggcgcacgacggcgtgaagctgtacgcgaagctgcccgcatgg
ttccgcgtgcagacgccgctcggcagctatcacccggactgggccgtgctcgcggaacag
gacggcggcgagcggctgtacttcgtcgtcgatacgccgaatgcggacggcaacgtgccg
agcgagcacgagcgtgcgaagctcgcgtgcggcgaagcgcatttccgcgcgctggtggac
ggcgacggcgcggcgcgcttcgtgcgcgtcaggcaggccgacgcgttgtttgagcctgcg
gtgccgctggtgggcaccgggcgataa

DBGET integrated database retrieval system