KEGG   Burkholderia sp. 383: Bcep18194_A3290Help
Entry
Bcep18194_A3290   CDS       T00286                                 

Definition
AMP-binding protein (EC:2.3.1.86)
Orthology
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
bur  Burkholderia sp. 383
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:123393..125120
Genome map
AA seq 575 aa AA seqDB search
MAADLGVGALIAPENGLSYVRGTTDVPLSEATIGRFLLDTAGRFPDRPAVVFREQQVRWT
WREFANEVDVLASGLASLGIVKGDRVGIWSPNRSEWLLTQFATARIGAVLVNINPAYRLS
ELEYALNKVGCKAVIAAERFKTSAYVEMLQTIAPELATATPGDLHAVRVPSLRTVVSMGD
VAPAGMFRFADVMARGRQAVDPALLDAIGATLAATEPINIQFTSGTTGSPKGATLTHRNV
VNNGRSIATAMRFTEQDTLCIPVPLYHCFGMVLAVLACVSKGAAMVFPGEAFDPVATLAA
VADERCTALHGVPTMFIAELDHPEFAKFDLSTLRTGIMAGSPCPIETMKRVVSQMHLSEI
TIAYGMTETSPVSFQSSTDDPLEKRTTTVGRIQPHLEVKVVDPSGGIVPVGATGELCTKG
YSVMLGYWDDDTKTREVLVDGWMHTGDLATLDADGYCNIVGRLKDMVIRGGENVYPREIE
EFLFRHPKIQSAQVFGVPDTKYGEELCAWIVLRADEQMTEDDVRAFCNGQIAHYKIPRYI
RFVDELPMTVTGKVQKFVMRDRMIEELKLDVQKTA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagaccttggcgtaggggcgctaatcgcgcccgaaaacggattgtcgtacgta
cgcggcacgaccgacgtaccgctgtccgaagcgacgatcggccggttcctgctggatacg
gccggccgctttcccgatcgtccggccgtcgtgttccgcgagcagcaggtgcgctggacc
tggcgcgaattcgcgaacgaggtcgatgtgctggcgtccggcctggcctcgctcggcatc
gtgaagggcgatcgcgtcggcatctggtcgccgaaccgcagcgaatggctgctcacgcag
ttcgcgaccgcgcggatcggcgcggtgctcgtcaacatcaatccggcctaccggctgtcg
gagctcgaatacgcgctgaacaaggtcggctgcaaggccgtgatcgccgccgagcgcttc
aagacgtccgcgtatgtcgagatgctgcagaccatcgcgccggagctcgcaaccgcgacg
ccgggcgacctgcatgcggtgcgcgtgccgagcctgcgcacggtcgtctcgatgggcgac
gtcgcgccggccggcatgttccgcttcgcggacgtgatggcgcgcggccgccaggccgtc
gaccccgcgttgctcgatgcgatcggcgcgacgctcgcggccaccgagccgatcaacatc
cagttcacgagcggcacgaccggcagcccgaagggcgcaacgctcacgcatcgcaacgtc
gtcaacaacgggcgctcgatcgcgacggcgatgcggttcaccgagcaggacacgctgtgc
atcccggtgccgctgtatcactgtttcgggatggtgctcgcggtgctcgcgtgcgtgtcg
aagggcgcggcgatggtgttcccgggcgaagcgttcgacccggtcgcgacgctcgcggcg
gtggccgacgagcgctgcaccgcgctgcatggcgtgccgacgatgttcatcgccgagctc
gatcaccccgagttcgcgaaattcgacctgtcgacgctacgcaccgggatcatggccggc
tcgccgtgcccgatcgagacgatgaagcgcgtcgtgtcgcagatgcacctgtcggagatc
acgatcgcgtacgggatgacggagacgagccccgtgtcgttccagagctccaccgacgat
ccgctcgagaagcgcacgacgacggtcgggcgcattcagccgcatctggaagtgaaggtc
gtcgatccgagcggcggcatcgtgccggtcggcgcgacgggcgagctgtgcacgaagggc
tattcggtgatgctcggctactgggacgacgacacgaagacgcgcgaggtgctggtggac
ggctggatgcatacgggcgacctcgcgacgctcgatgcggacggctactgcaatatcgtc
ggccggctgaaggacatggtgattcgcggcggcgagaacgtctatccgcgcgagatcgag
gaattcctgtttcggcatccgaagatccagagcgcgcaggtattcggcgtgcccgatacg
aagtacggcgaagagctgtgcgcatggatcgtgctgcgcgccgacgagcagatgaccgag
gacgacgtgcgtgcgttctgcaacgggcagatcgcgcactacaagattccgcgctacatc
cgcttcgtcgacgagctgccgatgacggtgacgggcaaggtgcagaagttcgtgatgcgt
gaccggatgatcgaggagctgaaactggacgtgcagaagaccgcgtag

DBGET integrated database retrieval system