KEGG   Burkholderia lata: Bcep18194_A3363Help
Entry
Bcep18194_A3363   CDS       T00286                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bur  Burkholderia lata
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bur00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcep18194_A3363
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bcep18194_A3363
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcep18194_A3363
Two-component system [BR:bur02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bcep18194_A3363
Bacterial motility proteins [BR:bur02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcep18194_A3363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:220727..221818
Genome map
AA seq 363 aa AA seqDB search
MTAVQKIKVLCVDDSALIRSLMTEIINSQPDMTVCATAPDPLVARELIKQHNPDVLTLDV
EMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGML
DYAEKLADKIRAASRARVRQAPQPQAVARAADSHPAAPMINNPLVSTEKLIIIGASTGGT
EAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIAVKEAEHGERVLPGHAYIA
PGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAATHAGKNAIGVILTGMGRDGA
AGLLEMKRAGAHTFAQDEASCIVFGMPREAIALGGADEIVPLAEMSRRVMARLATMGDRV
QRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtgcagaagatcaaagtattgtgcgtcgacgattcggcgctgatccgcagc
ctgatgaccgagatcatcaacagccagccggacatgacggtgtgcgcgaccgcgcccgat
ccgctcgtcgcgcgcgagctcatcaagcagcacaaccccgacgtgctcacgctcgacgtc
gaaatgccgcgcatggacgggctcgacttcctcgagaagctgatgcgcctgcggccgatg
ccggtcgtgatggtgtcgtcgctgaccgagcgcggctcggaaatcacgctgcgcgcactc
gaactcggcgcggtcgatttcgtcacgaagccgcgcgtcgggattcgcgacgggatgctc
gactacgcggaaaagctcgccgacaagatccgcgcggcgtcgcgtgcgcgcgtgcgccag
gcgccgcagccgcaggccgtggcgcgcgcggcggacagccacccggccgcaccgatgatc
aacaacccgctcgtcagtaccgagaagctgatcatcatcggcgcgtcgacgggcggcacc
gaggcgatccgcgaagtgctgacgccgctgccgccggatgcgccggcggtgctgatcgcg
cagcacatgccgccgggcttcacgaagtcgttcgcgcagcgcctgaacggcctgtgccgg
atcgcggtgaaggaagccgagcacggcgagcgcgtgctgccgggccacgcgtatattgcg
ccgggccacgcgcacctgttgcttgcgagaagcggggcgaactatattgcgcaactgtcg
gacgagccgccggtgaaccggcaccgtccgtcggtcgacgtgctgttccgctcggcggcg
acgcacgcgggcaagaacgcgatcggggtgatcctgaccgggatgggccgcgacggcgcg
gccggcctgctggaaatgaaacgcgcgggcgctcacacgttcgcgcaggatgaagcaagc
tgcatcgtgttcggcatgccgcgcgaggcgatcgcgctcggcggcgcggacgagatcgtg
ccgctcgccgagatgagccgccgcgtgatggcgcgcctggcgacaatgggcgaccgcgtg
cagcgcgtttga

DBGET integrated database retrieval system