KEGG   Burkholderia lata: Bcep18194_A3521Help
Entry
Bcep18194_A3521   CDS       T00286                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
  KO
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bur  Burkholderia lata
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep18194_A3521
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcep18194_A3521
Enzymes [BR:bur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Bcep18194_A3521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:387531..388880
Genome map
AA seq 449 aa AA seqDB search
MQVTVNERDAVQSVATAHPAANGESHGHGMDKLVIEGGHRLSGEIVVSGAKNAALPILCA
GLLTGDPVDLDNVPNLKDVRTTLKVLNQMGVKSETDGCRVQLDASRVDNLVAPYELVKTM
RASILVLGPLLARFGEAKVSLPGGCAIGARPVDQHIKGLQAMGAEISIEHGFIEARAKRL
KGARIVTDMITVTGTENLLMAATLADGETVIENAAREPEVSDLAHLLVAMGAKIDGIGTD
RLVIQGVERLHGARHSVIPDRIEAGTFLCAVAAAGGDVRLTGVRPHILDAVIDKLREAGV
SIEEGDSWLRVKMDRRPSAVTIRTSEYPAFPTDMQAQFMALNTVATGTAQVVETIFENRF
MHVQELNRLGANITIDGNTALVTGVDKLSGANVMATDLRASASLVIAGLRAEGETLVDRI
YHLDRGYDRMEAKLTAVGANVRRLSGSQA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtcaccgtcaacgagcgcgacgcggtccagagcgtcgccacggcacacccggcc
gccaacggggaatcgcatggccatgggatggacaagctcgtgatcgaaggcggccaccgc
ctgtcgggcgagatcgtcgtgtcgggcgcgaagaatgccgcgctgccgatcctgtgcgcg
gggctgctcaccggggatccggtcgatctcgacaacgtgccgaatctcaaggacgtgcgt
accacgctgaaggtgctgaaccagatgggcgtgaagagcgagacggacggctgccgcgtg
cagctcgacgcgtcgcgcgtcgacaacctcgtcgcgccgtacgagctcgtgaagacgatg
cgtgcgtcgatcctcgtgctcgggccgctgctcgcacgcttcggcgaggcgaaggtgtcg
ctgccgggcggctgcgcgatcggcgcgcgtccggtcgaccagcacatcaagggcctgcag
gcgatgggcgccgagatcagcatcgagcacggcttcatcgaagcccgcgcgaagcgcctg
aagggcgcgcgcatcgtgaccgacatgatcacggtgacgggcacggaaaacctgctgatg
gccgcgacgctcgccgatggcgagacggtgatcgaaaacgccgcgcgcgagccggaagtg
agcgatctcgcacacttgctggtcgcgatgggcgcgaaaatcgacggcatcggcaccgat
cgcctcgtgatccagggcgtcgagcggctgcacggcgcgcgccattcggtgatccccgac
cgcatcgaggccggcacgttcctgtgcgcggtcgcggcggccggcggcgacgtgaggctg
acgggcgtgcgcccgcacatcctcgatgcggtgatcgacaagctgcgcgaagccggcgtg
tcgatcgaggaaggcgacagctggctgcgcgtgaagatggaccgccggccgtcggcggtg
acgatccgcacgtcggaatacccggcgttcccgaccgacatgcaggcgcagttcatggcc
ctcaatacggtcgcgacgggcaccgcgcaggtcgtcgaaaccattttcgagaaccgtttc
atgcacgtgcaggagctgaaccggctcggcgcgaacatcacgatcgacggcaacaccgcg
ctcgtgacgggtgtggacaagctgtcgggcgcgaacgtgatggcgaccgacctgcgtgcg
tcggcgagcctcgtgatcgccgggctgcgtgccgaaggcgaaacgctggtcgaccgcatc
tatcacctggaccgcggctacgaccgcatggaagccaaactgaccgccgtcggcgcgaac
gtgcgccgactttccgggagccaagcatga

DBGET integrated database retrieval system