KEGG   Burkholderia lata: Bcep18194_A3618Help
Entry
Bcep18194_A3618   CDS       T00286                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bur  Burkholderia lata
Pathway
bur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01130  Biosynthesis of antibiotics
bur01230  Biosynthesis of amino acids
Module
bur_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcep18194_A3618
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bcep18194_A3618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABB07219
UniProt: Q39JZ7
Position
1:complement(492357..493142)
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEVAAAMRSAPLEALKLEASARDLRDFVGALRAKHAAGHAAVISEIK
KASPSKGVLREHFVPADIARSYAEHGAACLSVLTDEQFFQGSVRYLEEARAACTLPVLRK
DFIVDAYQIMEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRNEMEQAL
TLKTPLLGINNRNLRTFETSIQTTLDMLDMIPSDRIVVTESGILSRTDVDTMRAANVNTF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaagtcgcagcggccatg
cgcagcgcgccgctcgaggcactgaaactggaagcatcggcacgcgacctgcgcgacttc
gtcggcgcactgcgcgcgaagcatgcggccggccacgcggccgtgatttccgaaatcaag
aaagccagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgt
tcgtatgccgagcacggcgccgcgtgcctgtcggtgctgaccgacgaacagttcttccag
ggcagcgtccgctacctcgaggaagcgcgcgcggcctgcacgctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcatggaagcgcgcgcgatgggcgccgacgcgatc
ctgctgatcgccgccgcgctcgacacgccgctgatgcaggatctcgaagcgtatgcgcac
tcgctcggcctcgcggtgctggtcgaagtccacgaccgcaacgagatggaacaggcgctg
acgctcaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgtcg
atccagaccacgctcgacatgctcgacatgattccgtctgaccgcatcgtcgtgaccgaa
tcgggcatcctgtcgcgcaccgacgtcgacacgatgcgtgcggcgaacgtgaacacgttc
ctcgtcggcgaagcattcatgcgcgccgaccagccgggcgaagagctcgcgcggatgttc
ttctga

DBGET integrated database retrieval system