KEGG   Burkholderia lata: Bcep18194_A3669Help
Entry
Bcep18194_A3669   CDS       T00286                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bur  Burkholderia lata
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcep18194_A3669
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcep18194_A3669
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bcep18194_A3669
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bcep18194_A3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:555275..556393
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHDIRTAQILLTHADLADRERYLN
ARSTMLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQSGLFT
ADPRKDPNATLVAEANAGAPELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
RETDVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTAGGKSL
LPIGVIDVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIESVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgcggattcgaagcgattggtggtgaaggtgggctccagcctcgtg
accaacgacggcaaggggctcgatcatgcagcaatcggccgttgggcggctcagatcgcc
gcactgcgcgcccagggcaaggaagtcgtgctcgtcagttcgggcgcgattgccgaaggg
atgcagcggctaggctggagcaagcggccgcgggaaatcgacgagttgcaggctgccgcc
gcagtcggccagatggggctcgcgcaggtctatgagagccgcttcaccgagcacgacatc
cgcaccgcgcagatcctgctgacgcatgccgacctggcggaccgcgagcgttacctgaat
gcacgttcgacgatgctgacgctgttgcggctcggcgtcgtgccgatcatcaacgagaac
gacacggtcgtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcgctcgtt
gcaaacctgatcgaaggcgatgcactgatcatcctgaccgaccagtcggggctgttcacc
gccgatccgcgcaaggatccgaatgcgacgctcgttgcagaagccaatgcaggcgcgccg
gaactcgaggcgatggccggcggcgcgggttcgagcctcggccgcggcgggatgctgacg
aagatcctcgcggcgaagcgcgcggcacacagcggcgcgaacaccgtgatcgcgagcggc
cgggagaccgacgtgctcgtgcgtctggcggccggcgaggcgatcggcacgcaactgatc
gcacgtaccgcgcggatggcggcgcgcaagcagtggatggccgaccaccttcaggtgcgc
ggccatgtcgtgatcgacgcgggcgcggtcgagaagctgacggccggcggcaagagcctg
ctgccgatcggcgtgatcgacgtgcagggtgcgttcgcgcgcggtgaagtcatcgcgtgt
gttggccccgacgggcgcgaagtggcgcgtgggctcacgaactacagcagtgcggagacg
aaactgattcaccgcaaaccgagcggcgagatcgaatccgtgctcggctacatgctggag
cccgagttgatccatcgcgacaacctggtgctggtgtga

DBGET integrated database retrieval system