KEGG   Burkholderia lata: Bcep18194_A3714Help
Entry
Bcep18194_A3714   CDS       T00286                                 

Definition
guanine-specific ribonuclease N1 and T1 (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bur  Burkholderia lata
Brite
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bcep18194_A3714
Transfer RNA biogenesis [BR:bur03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bcep18194_A3714
 Prokaryotic Type
    Bcep18194_A3714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:604078..604509
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYAREAVPADVAASGLDTIPTARLPRE
AVTTLGLIGAGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTGDHYSSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcttacgcacgggaggccgtt
ccggccgacgtggcggcgagcgggctcgatacgattccgaccgcccgtcttccgcgcgag
gccgtgaccacgctgggcctgattggcgccggcggcccctatccgtacgagaaagacggc
gtcgtgtttggcaaccgcgagcggatcctgccaaaagcgaagcgcggctactaccatgag
tacacggtaccgacgccgcgtgcccgcaatcgcggtgcgcgccggatcgtctgtggcggg
ccattgcgccggatcgacaactgttattacacgggcgaccactacagcagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system