KEGG   Burkholderia sp. 383: Bcep18194_A3965Help
Entry
Bcep18194_A3965   CDS       T00286                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bur  Burkholderia sp. 383
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bur00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bur00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:885882..887027
Genome map
AA seq 381 aa AA seqDB search
MRSSRCASRRTAPERHANRIPGRWFAPRPVCIVGITHTMTTDTTGRTGNPAATASPDRFR
YGFLKGNPQLTKNGELKHLLSIEGLPRSIVNHILDTAEQFVSVTDREVKKVPLLRGKSVF
NLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKGESLLDTINNLSAMHADLFVVRH
ASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKRDFTKLRVAIVGDILH
SRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVKVFHNLDEGLKGVDVIIMLRLQN
ERMSGALLPSAQEYFKTWGLTPERLALAAPDAIVMHPGPMNRGVEIDSQVADGPQSVILN
QVTFGIAVRMAVMGIVAGNSD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagttcacgctgcgcgtcgaggcgcacggcgcctgaacgacacgcgaaccgtatc
ccgggccgctggtttgcaccgcggcccgtttgcatagttggaatcacgcacaccatgacc
accgacaccactggccgcaccggcaatcccgctgcgaccgcgagccccgaccggttccgc
tacggcttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaagcacctgctg
tcgatcgagggcctgccgcgctcgatcgtcaaccacatcctcgatacggccgagcagttc
gtcagcgtgacggaccgtgaagtgaagaaagtgccgctgctgcgcggcaagtccgtgttc
aacctgttcttcgagaactcgacgcgcacgcgcacgaccttcgagatcgcggcgacgcgc
ctgtcggccgacgtgctgaacctgaacatcaacgcatcgtcgacgagcaagggcgaatcg
ctgctcgacacgatcaacaacctgtcggcgatgcatgccgacctgttcgtcgtgcgtcac
gcgtcgagcggcgcaccgtacctgatcgccgagcactgcgcaccgcacgtgcacgtgatc
aacgccggcgacggccgccatgcgcacccgacgcagggcctgctcgacatgtacacgatc
cgtcactacaagcgcgacttcacgaagctgcgcgtggcgatcgtcggcgacatcctgcat
tcgcgcgtcgcgcgctccgacattcacgcgctcaccacgctcggcgtgccggaagtgcgc
gcgatcggcccgcgcacgctgctgccgggtggcctcgagcagatgggcgtgaaggtgttc
cacaacctcgacgaagggctgaagggcgtcgacgtgatcatcatgctgcgcctgcagaac
gagcggatgagcggcgcgctgctgccgtcggcgcaggaatacttcaagacctggggcctg
acgcccgagcgcctcgcgctcgccgcgcccgacgcgatcgtgatgcacccgggcccgatg
aaccgcggcgtcgagatcgattcgcaggtcgccgatggcccgcagtcggtgatcctcaac
caggtcacgttcggtatcgccgtgcggatggcggtgatgggcatcgtcgccggcaacagc
gactga

DBGET integrated database retrieval system