KEGG   Burkholderia lata: Bcep18194_A3990Help
Entry
Bcep18194_A3990   CDS       T00286                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bur  Burkholderia lata
Pathway
bur00010  Glycolysis / Gluconeogenesis
bur00030  Pentose phosphate pathway
bur00051  Fructose and mannose metabolism
bur00052  Galactose metabolism
bur00230  Purine metabolism
bur00500  Starch and sucrose metabolism
bur00520  Amino sugar and nucleotide sugar metabolism
bur00521  Streptomycin biosynthesis
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_A3990
   00030 Pentose phosphate pathway
    Bcep18194_A3990
   00051 Fructose and mannose metabolism
    Bcep18194_A3990
   00052 Galactose metabolism
    Bcep18194_A3990
   00500 Starch and sucrose metabolism
    Bcep18194_A3990
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep18194_A3990
  Nucleotide metabolism
   00230 Purine metabolism
    Bcep18194_A3990
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcep18194_A3990
Enzymes [BR:bur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bcep18194_A3990
    5.4.2.8  phosphomannomutase
     Bcep18194_A3990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABB07589
UniProt: Q39IX7
Position
1:916941..918335
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDTDTARAIGRAFGSEVRAQGGDAVVVARDGRLSGPDLVGA
LADGLRAAGVDVVDVGMVPTPVGYFAANVPLALKDGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYQRIVDERFETGNGSYEQFDVADQYIARIVGDIKPARPMKLVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWIKSKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTKTADP
SALLNGLPDAMSTPELQLWLDEGENFRLIDKLQKEAKFDGAEEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFESETQEGLKRIQEDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacattcgtggtgtggtcggcaagacgctc
gacaccgacaccgcgcgcgcgatcggccgggcgttcggcagcgaagtgcgcgcgcagggc
ggcgatgcggtggtcgtcgcgcgcgacggccgcctgtccgggccggacctcgtcggcgcg
ctggccgacggcctgcgtgcggcgggcgtcgacgtcgtcgacgtcggcatggtgcccacg
ccggtcggctatttcgcggcgaacgtcccgctcgcgctgaaggacggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgccgcgatctacggcgagcagatccaggcgctgtatcagcgcatcgtc
gacgagcgtttcgagacgggcaacggctcgtacgaacagttcgacgtggccgatcaatac
atcgcacgcatcgtcggcgacatcaagccggcccgcccgatgaagctcgtcgtcgacgcc
ggcaacggcgtggccggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgagctg
gtggagcgtttcaccgacatcgacggcacgttcccgaaccatcaccccgatcccgcccac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgacgccgagatcggcttc
gcgttcgacggcgatggcgaccggctcggcgtcgtcacgaaggatggccagatcatctat
ccggaccgccagctgatgctgttcgcggaagaggtgctgtcgcgcaacccgggcgcgcag
atcatctatgacgtgaagtgcacgcgccacctcgcgcagtggatcaagtcgaagggtggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggt
gcgccgctcgccggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggtctctacacgggcgcacgcctgctcgagatcctcacgaagacggccgatccg
agcgcgctgctgaacgggctgccggacgcgatgagcacgcccgaactgcagctgtggctc
gacgaaggcgagaacttccgcctgatcgacaagctgcagaaagaggcgaagttcgacggt
gcagaggaagtcgtgacgatcgacggcctgcgtgtcgagtacccggacggcttcggcctc
gcgcgttcgtcgaacacgacgccggtcgtcgtgatgcgtttcgagtcggagacgcaggaa
gggctcaagcgcatccaggaggacttccgccgcgtgctgacggccgcgaagccggacgtc
aagctgccgttctga

DBGET integrated database retrieval system