KEGG   Burkholderia sp. 383: Bcep18194_A4068Help
Entry
Bcep18194_A4068   CDS       T00286                                 

Definition
bifunctional glucokinase/RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bur  Burkholderia sp. 383
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bur01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bur00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bur00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bur00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bur00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bur00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(993582..995510)
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAAVAGQHADGPRLLADVGGTNARFALETGPGDITQIRVYPGADYPTLTDAIR
KYLKDVKITRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGARRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAATVDTVEIVERAHA
GDALALETVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLENIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS
TNGELPEAVAQAKARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggcggccgtcgcaggccagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgcttcgcgctggaaaccggcccgggcgac
atcacgcagatccgcgtgtatcccggcgccgactatccgacgctcaccgacgcgatccgc
aaatacctgaaggacgtgaagatcacccgcgtgaaccacgcggcgatcgcgatcgccaat
ccggtcgacggcgaccaggtcacgatgaccaaccacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctcgtcgtcaacgatttcaccgcgctcgcg
atggcgctgccgggcctgaccgacgcgcagcgcgtgcagatcggcggcggcgcgcgccgc
cagaacagcgtgatcgggctgctcgggcccggcaccgggctcggcgtgtcggggctgatt
ccggccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcatcgttcgcaccg
caggacgagcgcgaggacctggtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgaacgcgtgtgcgcgggccccggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcgtggccgcgaccgtcgacacggtcgagatcgtcgaacgcgcgcatgcg
ggcgacgcactcgcgctcgagacggttgaatgcttctgcggaattctcggcgcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtgtacatcggcggcggtgtcgcg
ctgaagctcggcgaactgttcacgcgctcgtcgttccgcgcgcgcttcgaggcaaagggc
cgcttcacgcactacctcgagaacatcccgacctacctgatcaccgccgaatacccggcg
ttcctcggcgtatcggcgatcctcgcggagcagctgtcgaaccgctcgggcggtgcgtcg
tcggccgtgttcgagcggatccgccagatgcgcgacgcactgacgccggccgagcgccgc
gtcgccgatctcgcactgaaccacccgcgctcgatcatcaacgatccgatcgtcgacatc
gcacgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgccaccggcctcaccggcacgatcccgatg
agccacagccaggtgcatctcggcgacacggccaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcagttgcgcgagcacctgaatttcgagcacgtcgagaac
gcgatcgagatcctgaacggcgcgcggcgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcattacaagttcttccgcttcgggatcccgacgatcgcgtac
ggcgacctgtacatgcaggccgcatcggccgcgctgctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcggggcgcgcgcccgagctgctgcgcgtgctcgacgtcgcgatgcag
gccggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgcaaagcgcgcgacc
gtcgcgctcgaaaccgaccacatcgagatgcgcgagtcgcagctgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacatcctcgcggtgggcgtcgcgatccgtcgtgcatcg
acgaacggcgaactgcccgaggccgtcgcgcaggcgaaggcccgtgcgagcgacgacgaa
acggccgacgtgctcgactggctgagccacggtgcatcgccggcggcgaaggacgtcgcg
cgggattga

DBGET integrated database retrieval system