KEGG   Burkholderia lata: Bcep18194_A4324Help
Entry
Bcep18194_A4324   CDS       T00286                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bur  Burkholderia lata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcep18194_A4324
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bcep18194_A4324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1276629..1278932
Genome map
AA seq 767 aa AA seqDB search
MNMNVQDDTLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPAAAARWAARAAF
ATSRATAGGHVCVALGALAQRYEAPLDEVRSALAASGVVAFGTLARGDERPLIVDRHDHL
YLSRYFDYERRLADALVAQAGVAAPDEGLAPARLRDSLARYFGPATGEVDWQRVAAIVAL
TGRVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRVALAAPTGKAAQRMQEALHARAGDLP
PELAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALA
PGARLVLLGDKDQLAAVEAGAVFAELSARPAFTAAARTRIAQALGIDEAAFVAALPVQDE
AVPAAPPVSAVARAPAALSASAVAATRKPASRRKVDERQASLFDDEPQDDEVSPTSAAPP
SAAGPMLTEAGDAGVAGEAPAWIEVDELEWLDAVELPPFDASDSALASVTSILSGESEAA
SATSTPAPAPLADCVVWLERNYRFGLDSPIGRLSLAIRSGDVQAALDALPADDSAAASFH
DDAGESLAASTVERLARRFGAYLDALRDTLAAPVPDPLPLFDALNRFRILCATRSGLRGA
EHVNALVAAHVRHAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPDAHGVLRV
WFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTRELVYTAV
TRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRMEASR
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaacgtgcaggacgacacgctcgaattcaccggcggcctcgtcgcgcggctg
cccgaaccggccgatttcggcatcgcgctcgcggaagggtttgcacgccgcatcggcgat
ctcgctcgccgcgccggcgcaccggctgcggccgcgcggtgggcggcgcgcgccgcgttc
gcgacgagtcgtgcgactgcgggcggccatgtgtgcgtcgcgctcggcgcgctcgcgcag
cgctacgaagcaccgctcgacgaagtccgctcggcgcttgccgcgagcggcgtggtcgcg
ttcggcacgctcgcgcgaggcgacgagcggccgctgatcgtcgaccgccacgaccacctg
tacctgtcgcgctatttcgactacgagcggcggcttgccgatgcgctcgtcgcgcaggcc
ggtgtggccgcgcccgacgaaggtctcgcgcccgcccggttgcgcgacagcctcgcgcgt
tacttcgggccggcaaccggcgaagtcgactggcaacgcgtcgcggcgatcgtcgcgctg
acgggccgcgtgacgatcgtcagcggcggcccgggcacgggcaagacgacgaccgtcgtc
ggcgtgctggcctgtctgctcgacgcacacccggggctgcgcgtcgcgctggccgcaccg
accggcaaggccgcgcagcggatgcaggaagcgctgcatgcgcgggccggcgacctgccg
cccgaactcgcggcgcgcctgcccgatacgtcatacacgctgcaccggctgctgggcggc
ggcggggcggccgggttccggcatcatcgcgacaatccgttgccgtacgacctaatcgtc
gtcgacgaggcgtcgatgatcgacgtcgcgctcgccgcgcatctgctcgatgcgctcgcg
ccgggtgcgcgactcgtgctgctcggtgacaaggaccaactggccgcggttgaagcgggc
gccgtattcgcggaactgagcgcgcggccggcgtttaccgccgcggcgcgcacgcgcatc
gcgcaggcgctcggcatcgacgaggcggccttcgtcgcggcattgccggtgcaggacgaa
gccgttcccgccgcgcccccggtttccgccgtcgcccgcgccccggcagctctctcggca
tccgctgtcgccgcgacacgcaaaccggcgtcgcgacgcaaagtcgatgaacgacaggca
tcgctcttcgacgacgaaccgcaggatgacgaagtgtcgccgaccagcgccgcgccgccg
tcggccgcaggtccgatgctgaccgaagccggtgacgctggagtggcaggcgaggccccc
gcgtggatcgaggtcgacgaacttgagtggctcgacgccgtcgagctgccgccgttcgac
gcaagcgacagtgcgcttgcgtcggtcacatcgatactgtcgggcgaatccgaagccgcg
tctgcaacgtctacgcccgcgcccgcaccgctcgccgactgcgtggtctggctcgaacgc
aattaccgcttcggtctcgattcgccgatcgggcggctgtcgctcgcgatccgcagcggc
gacgtgcaggccgcgctcgacgcgctgcccgccgacgattccgccgccgcgtcgttccac
gacgacgcgggcgagtcgctcgcggcgtcgacggtcgagcggctcgcgcggcgcttcggt
gcctatctcgacgcgttgcgcgacacgctggccgcgccggtgcccgatccgctgccgctg
ttcgacgcgctcaaccggttccggatcctgtgtgcaacccgcagcggcttgcgcggcgcg
gagcacgtcaatgcgctcgtggccgcgcacgtgcgccacgcggcgcgtgtgccgctcgcg
gtcggcgcgcactggttcacggggcggccgatcatggtgacgcgcaacgactatgcgctc
gggctgttcaacggcgatatcggcatcgcgctgcccgacgcgcacggcgtgttgcgcgtg
tggttcaggcgtgcggacggcaccgcgcgcgctgtgtcgccggccgcgttgccgccgcac
gaaaccgcgttcgcgttgacggtccacaagtcgcagggctcggaattcgacgaagccgcg
ctcgtgctgccggcgtcgttcggccgcgtgctcacgcgcgaactggtctatacggccgtc
acgcgtgcccgcacgcgcgtgcaggtgatcgggccgcggcgtgtgctggcgcaggcggtc
gcgacgcgcacgcagcgcgactcggggctcgcggcacgcgtcgacgaggcgcttgcacgg
cgccgcatggaggcgtcgcgatga

DBGET integrated database retrieval system