KEGG   Burkholderia lata: Bcep18194_A4526Help
Entry
Bcep18194_A4526   CDS       T00286                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1491936..1493165
Genome map
AA seq 409 aa AA seqDB search
MARAMAKRRAMRPARRVGAALALAVAVTCAAAGMATRAQAAGAGAADAANAGCGAAWPRW
DAFKRDFISADGRVIDVGSADSRTVSEGQAYGLFFALVANDRRMFDTILAWTENNLAQGD
LSAHLPAWLWGRAPDGAWRVLDANAASDADLWIAYALVEAGRLWHERSYTARGALLAKRV
LDDETATVPGLGLTLLPGPTGFKLADGQWRVNPSYSPPQVIRALGARLPDDKRWAALVSS
TGRVLLDTAPKGFSPDWALYRAGTGFGPDRDTHAESAYNAIRVYLWAGMLDRADPLAAPM
LARFTPFADYIAAHGAPPEKVDTTTGVAGPNDGNGGFSAAAVPFLDARGQRALADAQAAR
VDTLARQSAPGYYTSVLTLFGLGWRDGRYRFGADGTLDARWGGRSCAAR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggcaatggcgaagcgacgggcaatgcggccggcgcggcgcgtcggcgcggca
ctcgcgctggcggttgcggtgacgtgcgcggcggccggcatggccacgcgcgcacaggcc
gcgggggccggtgcagccgacgcggccaacgcagggtgcggtgcggcgtggccgcgctgg
gacgcgttcaagcgcgatttcatctcggccgacggccgcgtgatcgacgtcggctcggcc
gattcacgcaccgtatcggaggggcaggcgtatggacttttcttcgcgctggtcgcgaac
gaccggcgcatgttcgacacgatcctcgcatggaccgagaacaatctcgcgcagggcgac
ctgagcgcgcatctgccggcgtggctgtggggccgcgcgcccgacggtgcgtggcgcgtg
ctcgacgcgaacgcggcgtcggacgccgacctgtggatcgcgtatgcgctcgtcgaggcc
gggcggctgtggcacgaacgcagctacacggcacgcggcgcgctgctcgcgaagcgcgtg
ctcgacgacgagacggcgaccgtgccgggccttggcctcacgctgctgccggggccgacg
gggttcaagctcgccgacggccagtggcgcgtgaacccgagctattcgccgccgcaggtg
atccgcgcgctcggcgcgcgcctgcccgacgacaagcgctgggccgcgctcgtctccagc
accggacgcgtgctgctcgacaccgcaccgaaaggcttttcgccggactgggcgctgtat
cgcgcgggcacgggtttcgggcccgatcgcgacacgcatgcggagagcgcgtacaacgcg
atccgcgtgtatctgtgggccggcatgctcgaccgtgccgatccgctcgccgcgccgatg
ctcgcccgttttacgccgttcgccgactacatcgccgcgcatggcgcgccgccggagaag
gtcgacacgacgacgggcgttgcggggccgaacgacggcaacggcgggttttccgcggcg
gccgtgccgttcctcgacgcacgcggccagcgtgcgctcgcggatgcccaggcggcgcgt
gtcgatacgctcgcgcgccagtcggcgcccggctactacacgagcgtgctgacgctgttc
gggctcggctggcgcgacggacgctaccggttcggtgcggacggcacgctcgacgcccgc
tggggaggccgctcgtgcgccgcccgctga

DBGET integrated database retrieval system