KEGG   Burkholderia lata: Bcep18194_A4584Help
Entry
Bcep18194_A4584   CDS       T00286                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bur  Burkholderia lata
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcep18194_A4584
   00052 Galactose metabolism
    Bcep18194_A4584
   00500 Starch and sucrose metabolism
    Bcep18194_A4584
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep18194_A4584
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcep18194_A4584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1560340..1561224)
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGNPPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKEWE
ESIVKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHAEVGAEFDTYLRTRNGGRPAD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagttaccaaggcagtgttccctgttgccggtctcggcacgcggttcctcccg
gcaacgaaagcgagcccgaaggaaatgctgccggtcgtcgacaagccgctgatccagtac
gcagtcgaggaagcgatcgccgccggcatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcacttcgacaagtcgtatgaagtcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcagcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgctgtgcgcggaaaag
ctcgtcgccgacaacccgttcgcggtgatcctcgccgacgacctgctcgacggcaacccg
cccgtgatgaagcagatggtcgacgtgttcgaccactatcacagctcggtgatcggcgtc
gaagagatcccgccgtcggagacgaagtcgtacgggatcgtcgatggcaaggagtgggag
gagtcgatcgtcaagatgtcggcgatcgtcgagaagccggcgccggaagtcgcgccgtcg
aacctcggcgtggtcggccgctacatcctgaagccgcggatcttcgagcacctgcgcgcg
ctgaagcccggcgcgggtggcgagctgcagctcaccgacgcgatccaggcgctgctcgcc
gatgagcaagtgctggcttacaagtaccagggcacgcgctacgactgcggcagcaagctc
ggctacctgaaggcgacggtcgaattcgcactgcgccacgcggaagtcggcgcggagttc
gacacgtacctgcgcacgcgcaacggcggacgcccggccgactga

DBGET integrated database retrieval system