KEGG   Burkholderia lata: Bcep18194_A4650Help
Entry
Bcep18194_A4650   CDS       T00286                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bur  Burkholderia lata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_A4650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep18194_A4650
  Amino acid metabolism
   00310 Lysine degradation
    Bcep18194_A4650
Enzymes [BR:bur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcep18194_A4650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1638518..1639792
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPVAAAASSTTA
SPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALPEV
KVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagttgctcaagacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacaccgtcgttgccgatcagatcatcgcgacgatcgacaccgaa
gcgaaggcgggtgcagccgaagccgccgcaggcgccgccgaagtcaagccggcagcagcg
cctgccgcagccgcaccggcagcacagccggtcgccgcagccgcatcgtcgacgaccgca
tcgccggccgcatcgaagctgctggccgagaagggcctgtcggcgggcgacgtcgcaggt
tcgggccgtgacggccgcgtcacgaagggcgacgcgctggcagcaggcagcgcaccgaag
gccgctccggctgccgcaccggccaagacggccgctgcgaagccggcgctgccggaagtg
aaggtgccggcatcggccgcgacctggctgaacgaccgtccggaacagcgcgtgccgatg
tcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgagtcgcagcagaccaacgcgatc
ctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgtaacaagtacaag
gacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaaggca
gctgtccacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaacgacatc
gtctaccacggctacttcgacatcggtatcgctgtcggctcgccgcgcggcctcgtcgtg
ccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgaaaagaagatcgccgag
ttcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacgttc
tcgatctcgaacggcggtgtgttcggctcgatgctgtcgaccccgatcatcaacccgccg
cagtcggccatcctcggcgtgcacgcgacgaaggagcgtccggtcgtcgaaaacggccag
atcgtgatccgtccgatcaactacctcgcgctgtcgtacgaccaccgcatcatcgacggc
cgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgtctg
ctgctcgacctgtaa

DBGET integrated database retrieval system