KEGG   Burkholderia lata: Bcep18194_A4807Help
Entry
Bcep18194_A4807   CDS       T00286                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bur  Burkholderia lata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcep18194_A4807
Enzymes [BR:bur01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Bcep18194_A4807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1824163..1825239
Genome map
AA seq 358 aa AA seqDB search
MTDPTTHRARAVFPFAALVAQDALQQALLLAAIDPSLGGVLVSGPRGTAKSTAARGLAEL
LPEGQFVTLPLSASDEQVTGTLDLAHALAENGVRFRPGLLARAHLGVLYVDEVNLLADGL
VDTLLDVAASGVNIVERDGVSHAHDARFVLIGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRTRHASAQRELGDRIHAARARLAALDFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEQADAVTVSHVERVADAVLRHRRHAGTPPSSRAPQQ
DDERNGHTPPDARERPDDSSGTAKNDATASQGDWGYLPPEPAGLRNVKGVVPLPLKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgacgacgcaccgcgcccgcgcggtttttccgtttgcggcgctcgtcgcg
caggatgcgctgcagcaggcgctgctgctcgccgcgatcgacccgtcgctgggcggcgtg
ctcgtgagcgggccgcgcggcaccgcgaaatcgaccgcggcgcgcggcctcgcggagctg
ttgcccgaagggcagttcgtcacgctgccgctgtcggcgagcgacgagcaggtgacgggt
acgctcgacctcgcgcatgcactcgctgaaaacggcgtgcgctttcggccgggcctgctc
gcgcgggctcatctcggcgtgctgtacgtcgacgaagtgaatctgctcgccgacgggctc
gtcgatacgctgctcgatgtcgccgcgagcggcgtgaacatcgtcgagcgcgatggcgtg
tcgcacgcgcacgatgcgcgtttcgtgctcattggcacgatgaatccggaggagggcgag
ctgcgtccgcaactgctcgaccgcttcggtttgatggtcgagctggagaactgcttcgac
gccgcgcagcgcgagcggatcgtaaaagcgcggcttgcattcgatctcgatccggatgcg
ttccgcacgcgtcacgcatccgctcaacgcgaactcggcgaccggattcacgcggcgcgc
gcacggctcgcggcgctcgatttcgacgatgcagtccatgcgcgcgtcagcgcgctgtgc
atcgacgcggccgtcgacgggctgcgggccgacctcgtgatgctgcgcgcggcgcgtgcg
cttgccgcgctggagcaggccgatgcggtgacggtgtcgcatgtggagcgtgtggccgac
gccgtgctgcggcaccggcgccatgcgggcacgcctccatcgtcgcgagcgccgcagcaa
gacgacgaacgcaacggccacacgccacccgatgcgcgcgagcgccccgacgattcgtcc
ggcacagcgaagaacgatgccacggcatcgcagggcgactggggctacctgccacccgag
ccggccgggctgcgcaacgtgaaaggcgtggtgccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system