KEGG   Burkholderia sp. 383: Bcep18194_A5123Help
Entry
Bcep18194_A5123   CDS       T00286                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bur  Burkholderia sp. 383
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2166413..2167345)
Genome map
AA seq 310 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSEGRAGERHAAVAGSKAADKPAAVLKPVAVKPAAVRTA
LPGSAAAKPATAPKPTALKPAMPKPAAPSVAPAGAFALTSERVRERMVERLRANGVTDAR
VLEAMAAVPRHMFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRTLERVLE
IGTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAP
FDAIVIAAAGLDVPQALLEQLAIGGRLVAPVGAQSGQHQVLTLVERVAHAQWRESRLDRV
FFVPLKSGVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaagatctcaagcgagcgcca
cgcaagtcggaaggtcgggccggcgaacgccatgcggcggtcgcgggttcgaaggccgcc
gacaagcccgcggccgtgctgaagccggttgcggtgaagcctgctgcggtgcgtacggca
ttgcccggttccgccgccgcgaagccggcgaccgcaccgaagccgaccgcgctgaagccc
gcgatgccgaagccggccgcgccgagcgtcgcgccggccggcgcgtttgcgctcacgtcg
gaacgtgtgcgcgaacggatggtcgaacggctgcgcgcgaacggtgtgaccgacgcgcgc
gtgctggaagcgatggccgcggtgccgcgacacatgttcgtggatccggggctcgcgacg
caggcttacgaggattcggcgttgccgatcggccaccagcagaccatttcaaagccgtcg
gtcgtcgcgcgcatgatcgagctcgcgatggccggccgcacgctcgagcgcgtgctcgag
atcggcacgggctgcggctaccaggccgccgtgctgagtcacgtggcacgcgacgtgtat
tcgattgaacgcatcaagccgctctacgagcgcgcgaagctgaacctgcggccgctgcgc
gtgccgaacatccgtctgcactacggcgacgggcgtgtcggcctgccgtccgcggccccg
ttcgacgcgatcgtgatcgcggcggcggggctcgacgtgccgcaggcgctgctcgagcag
cttgcgatcggcgggcggctcgtcgcgccggtcggcgcgcagagcgggcagcaccaggtg
ctcacgctcgtcgagcgcgtcgcgcacgcgcaatggcgggagtcacggcttgatcgcgtt
ttctttgtccctttaaaatccggagtaatttga

DBGET integrated database retrieval system