KEGG   Burkholderia sp. 383: Bcep18194_A5126Help
Entry
Bcep18194_A5126   CDS       T00286                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bur  Burkholderia sp. 383
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bur03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2169580..2170176)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtctgctctcgtcgaagcattgcgcgtgctgcccggcgtc
gggccgaaatccgcccagcgcatggcggtccacctgatgcagcacgatcgggagggcgcg
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcaccgaagcgcagatctgcgaggtctgcagcgacgaagagcgtgatccgacg
ctgctgtgcgtcgtcgagacgcctgccgatcagatcatgctcgagcagacgatgacttac
cgcgggctgtatttcgtgctgatgggccggctgagcccgctcgacgggatcggcccgaag
gaaatccatttcgaccgcctcgtgcggcgcgcgtccgacggcgtcgtcaaggaagtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagccaccgcgcactacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcgcgcggcgtgccggtgggcggcgagctc
gaatacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccgcactatgtaa

DBGET integrated database retrieval system