KEGG   Burkholderia lata: Bcep18194_A5154Help
Entry
Bcep18194_A5154   CDS       T00286                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bur  Burkholderia lata
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcep18194_A5154
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_A5154
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcep18194_A5154
Enzymes [BR:bur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcep18194_A5154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2199641..2201092)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPTVSADELARWRSLSYADLAFEI
LSKFCDDVPADDLRAITRRTYTADVYRNTRHGENASDITPLKTLGTENGAPISLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGQTLNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATQSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFSRVAEFGFVSGSSSHTDRIATIRDVFSRYDTMIDTHTADGVKVAREHLDA
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVNADAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgccacacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcgggctctacctgccggccgagtatccgacggtg
tccgccgacgagctcgcacgctggcgctcgctgtcgtacgcggatctggcgttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgtcgcacg
tacacggccgacgtgtaccgcaacacgcgccatggcgagaacgcgtccgacatcacgccg
ctgaagacgctcggcaccgagaacggcgcgccgatctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcaaagcacgggcagacgctgaacattctcggcgcgacgtccggcgacaccggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcccagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctacttcgcagcgacgcagtccaacgac
gaacgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtctgcgcaggccacatc
gcgcggatgatggggctgccgatcgcaaagctggtggtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcacgggcgcgtatcgcgtgcgcagcgccgagaacacctatcac
acgagcagcccgagcatggacatttcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcacgcgtgatgcagctgttccgcgacgtcgaggagaagggc
ggcttcgatctcgcggcgagcggcgatttctcgcgcgtcgccgagttcggtttcgtgtcg
ggcagcagcagccacacggaccgcatcgcgacgatccgtgacgtgttctcgcgctacgac
acgatgatcgatacgcatacggccgacggcgtgaaggtcgcgcgcgagcatctcgacgcg
ggtgtgccgatggtcgtgctcgagacggcgcagccgatcaagttcggcgagacgattcgc
gaagcactcgatcgcgaagccgagcgtccggctgcattcgacgggctcgaggcgctgccg
cagcgtttcgaggtcgtgaacgccgatgcgcagcaggtgaaggacttcatcgccgcccat
acgggcgcatga

DBGET integrated database retrieval system