KEGG   Burkholderia lata: Bcep18194_A5220Help
Entry
Bcep18194_A5220   CDS       T00286                                 

Definition
lipolytic protein (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bur  Burkholderia lata
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bcep18194_A5220
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcep18194_A5220
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bcep18194_A5220
Lipid biosynthesis proteins [BR:bur01004]
 Fatty acid synthase
  Component type
   Bcep18194_A5220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2272076..2272750
Genome map
AA seq 224 aa AA seqDB search
MDTTFRWKRRAAFAALLGTLLAATVSARAATTPAATSGQPVIVVLGDSLSAEYGLPRDTG
WVALLRQRLTTERIDYSVANASVSGDTTSGGRARLPAVLQRLKPSIVVVELGSNDALRGV
PLATTEQNLRDIIAGARQARAKVVLVGMYVPPNYGPDYTQKFHAVYTRLSKDLGVPLVPF
LLAGIENKPELFQADQMHPAQQAQGILLDNVWPALKPLLGKPRG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacatttcgctggaaaagacgcgcggcgttcgccgcgctgctgggcaccctg
ctggccgccaccgtatcggcacgcgctgcgacgacgccggccgcgacatcgggccagccc
gtgatcgtcgtgctcggcgacagcctgtcggccgaatacgggttgccgcgcgacaccggc
tgggtggcattgctgcggcaacggctcacgaccgagcgaatcgattatagcgtcgcgaac
gccagcgtcagcggcgacaccacgagcggcggccgagcgcggctgcccgcggtgctgcaa
cggctcaagccgtcgatcgtcgtcgtcgagctcgggtcgaacgatgcgctgcgcggcgtg
ccgctcgccacgaccgagcagaacctgcgcgacatcatcgccggcgcgcggcaggcgcgg
gcgaaggtcgtgctggtcggcatgtacgtgccacccaattacggccccgactacacgcag
aagttccacgccgtctatacgcggctgtcgaaggatctcggcgtgccgctcgtgccgttc
ctgctggccggcatcgagaacaagccggagttgttccaggccgaccagatgcatcctgcg
cagcaggcgcagggcattctgctcgacaacgtctggccggcgctgaaaccgctgctcggc
aagccgcgcggctga

DBGET integrated database retrieval system