KEGG   Burkholderia lata: Bcep18194_A5344Help
Entry
Bcep18194_A5344   CDS       T00286                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bur  Burkholderia lata
Pathway
bur00480  Glutathione metabolism
bur00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bcep18194_A5344
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep18194_A5344
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bcep18194_A5344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABB08938
UniProt: Q39F28
Position
1:complement(2403045..2403524)
Genome map
AA seq 159 aa AA seqDB search
MSTLYSFSAETLAGAPASLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDQYAARGFYVL
GFPCNQFGKQEPGDAAQIGAFCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGL
KAIKWNFTKFLVDREGRIVKRYAPSTKPDEIAADIDKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctgtattcgttcagcgcagagacgcttgccggcgcgccggcctcgctcgac
gcgtatcgcggcaaggtgctgctgatcgtcaacaccgcgagcgagtgtggtttcacgccg
cagtacgcgggcctgcagaagctgtacgaccagtacgcggcgcgcggtttctatgtgctc
ggcttcccgtgcaaccagttcggcaagcaggagcccggcgacgccgcgcaaatcggcgcg
ttctgcgagcgcaattacggcgtcacgttcccgatgttcgcgaagatcgacgtgaagggc
gaccatgcgcatccgctgtaccgctacctgaccgacgaggcgcccggcattctcggcctc
aaggcgatcaagtggaatttcacgaaattcctggtcgatcgcgaagggcgcatcgtcaag
cgctacgcgccgtcgaccaagccggacgaaatcgccgcggatatcgacaagctgctgtga

DBGET integrated database retrieval system