KEGG   Burkholderia lata: Bcep18194_A5361Help
Entry
Bcep18194_A5361   CDS       T00286                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bur  Burkholderia lata
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_A5361
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep18194_A5361
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep18194_A5361
Enzymes [BR:bur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcep18194_A5361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2421046..2422638
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMAITGEIKPGYEAILTPEALELVAALHRTFEPRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYQLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEGVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLAERSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIAKQRDDVQVEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
RELSKAELDNVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatggcgatcaccggcgaaatcaagccgggt
tacgaagcaatcctgacgcctgaagcgctcgaactcgtcgcagcgctgcaccgcacgttc
gagccgcgccgccaggcgctgctgcaggcgcgcgtggagcgcacgaaacgcctcgacgcg
ggcgaacgccccgacttcctggccgagacgaaggcgatccgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgtcgtgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgcggattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtaccagctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgcgtctccggcggcattttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgctcgcgcgcggctcgggcccgtacttctacctgccgaagatggagagccatctcgag
gcacgcctgtggaacgacatcttcgtcgccgcgcaggaaggcgtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggccatcaagaagttcaagaacgaccgcgacttctgcctcgccgagcgttcgaagatc
acgatgaccgtgccgttcatgcgcgcgtatgcgctgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagagttcgtc
aaggtgctcggcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcaggtcgaa
ggcaagaacctgctcgacttccagcccgaagcgccgatcaccgaagccggcctgcgcaac
aacatcaacgtcggcatccactacctcggcgcatggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagatgcggccacggccgaaatctcccgctcgcaggtgtggcaa
tggatccgctcgccgaagggtgtgctcgacgacggccgcaaggtcaccgccgaactcgtg
cgtgaactctcgaaggccgagctggacaacgtgaagcgctcggtcggcggcaacacgcag
ccgtacgagcgcgccgcggcgatcttcgagcagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system