KEGG   Burkholderia sp. 383: Bcep18194_A5361Help
Entry
Bcep18194_A5361   CDS       T00286                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bur  Burkholderia sp. 383
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bur01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bur00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bur00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2421046..2422638
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMAITGEIKPGYEAILTPEALELVAALHRTFEPRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYQLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEGVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLAERSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIAKQRDDVQVEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
RELSKAELDNVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatggcgatcaccggcgaaatcaagccgggt
tacgaagcaatcctgacgcctgaagcgctcgaactcgtcgcagcgctgcaccgcacgttc
gagccgcgccgccaggcgctgctgcaggcgcgcgtggagcgcacgaaacgcctcgacgcg
ggcgaacgccccgacttcctggccgagacgaaggcgatccgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgtcgtgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgcggattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtaccagctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgcgtctccggcggcattttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgctcgcgcgcggctcgggcccgtacttctacctgccgaagatggagagccatctcgag
gcacgcctgtggaacgacatcttcgtcgccgcgcaggaaggcgtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggccatcaagaagttcaagaacgaccgcgacttctgcctcgccgagcgttcgaagatc
acgatgaccgtgccgttcatgcgcgcgtatgcgctgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagagttcgtc
aaggtgctcggcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcaggtcgaa
ggcaagaacctgctcgacttccagcccgaagcgccgatcaccgaagccggcctgcgcaac
aacatcaacgtcggcatccactacctcggcgcatggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagatgcggccacggccgaaatctcccgctcgcaggtgtggcaa
tggatccgctcgccgaagggtgtgctcgacgacggccgcaaggtcaccgccgaactcgtg
cgtgaactctcgaaggccgagctggacaacgtgaagcgctcggtcggcggcaacacgcag
ccgtacgagcgcgccgcggcgatcttcgagcagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system