KEGG   Burkholderia sp. 383: Bcep18194_A5480Help
Entry
Bcep18194_A5480   CDS       T00286                                 

Definition
urocanate hydratase (EC:4.2.1.49)
Orthology
K01712  
urocanate hydratase [EC:4.2.1.49]
Organism
bur  Burkholderia sp. 383
Pathway
Histidine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bur00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2565182..2566870)
Genome map
AA seq 562 aa AA seqDB search
MNHPKHIDPRLDPTRTIRAPRGSEKVCKTWLAEAAYRMIQNNLDPEVAEHPHALVVYGGI
GRAARNWECYDQILASLKDLEENETLLIQSGKPVGVFRTHKDAPRVLLANSNLVPHWANW
DHFHELDRKGLMMYGQMTAGSWIYIGSQGIVQGTYETFFSVANQHFNGDPSGRWILTGGL
GGMGGAQPLAATMAGFSMIAVECDETRIDFRLKTRYVDKKATTLDEALGMIEEAKRDGKP
VSIGLLGNAADVFAELVTRGITPDCVTDQTSAHDPINGYLPQGWTVAQWREAQKVDPQSI
VKVAKQSMAVQVRAMLALQERGAATLDYGNNIRQMALEMGVENAFDFPGFVPAYIRPLFC
EGKGPFRWVALSGDPEDIYKTDQKVKELIPDDPHLHNWLDMARERIAFQGLPARICWVGV
KDRYRLGQAFNEMVKNGELKAPIVIGRDHLDTGSVASPNRETESMKDGSDAVSDWPLLNA
LLNTAGGASWVSLHHGGGVGMGFSQHSGVVIVADGTAEAHERLGRVLLNDPATGVMRHAD
AGYELAQQTAREAGLKLPMLGR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatccgaaacacatcgatccccgtctcgatccgacccgcacgatccgtgcgccg
cgcggcagcgagaaagtctgcaagacctggctggccgaagcggcctaccggatgatccag
aacaacctcgacccggaagtcgccgagcatccgcatgcgctcgtcgtgtacggcggcatc
ggccgcgcggcacgcaactgggaatgctacgaccagatcctcgcgtcgctgaaggatctc
gaagagaacgagacgctgctgatccagtcgggcaagccggtcggtgtgttccgcacgcac
aaggatgcgccgcgcgtgctgctcgcgaactcgaacctggtgccgcactgggcgaactgg
gatcacttccacgagctcgaccgcaagggcctgatgatgtacggccagatgacggccggc
agctggatctacatcggcagccagggcatcgttcagggcacctatgaaacgttcttctcg
gtcgcgaaccagcacttcaacggcgatccgtcgggccgctggatcctgacgggcggcctc
ggcggcatgggcggcgcgcagccgctggccgcgacgatggccggtttctcgatgatcgcg
gtcgaatgcgacgagacccgcatcgacttccgcctgaagacgcgctacgtcgacaagaag
gcaacgacgctcgacgaagcgctcggcatgatcgaggaagcgaagcgcgacggcaagccg
gtgtcgatcggcctgctcggcaacgcggccgacgtgttcgcggaactcgtcacgcgcggc
atcacgccggattgcgtgaccgaccagacgagcgcgcacgacccgatcaacggctacctg
ccgcaaggctggaccgtcgcgcaatggcgcgaagcgcagaaggtcgatccgcagagcatc
gtgaaggtcgcgaagcagtcgatggccgtccaggtgcgcgcaatgctggcgctgcaggaa
cgcggtgcggcgacgctcgactacggcaacaacatccgccagatggcgctggaaatgggt
gtcgagaacgcattcgacttcccgggcttcgtgccggcgtacatccgcccgctgttctgc
gaaggcaagggcccgttccgctgggtcgcgctgtcgggcgatccggaagacatctacaag
accgaccagaaggtgaaggagctgatccccgacgatccgcacctgcacaactggctcgac
atggcacgtgagcgcattgcgttccagggcctgccggcacggatctgctgggtcggcgtg
aaggatcgctatcgcctcggccaggcgttcaacgagatggtcaagaacggcgaactgaag
gccccgatcgtgatcggccgcgaccacctggacaccggctcggttgccagcccgaaccgc
gagacggaatcgatgaaggacggttcggacgccgtgagcgactggccgctgctgaacgca
ctgctgaacaccgcaggcggcgcttcgtgggtgtcgctgcaccatggcggtggtgtcggc
atgggcttctcgcagcactcgggcgtcgtgatcgtcgccgacggtaccgccgaagcgcac
gagcgtctcggccgcgtgctgctgaacgacccggcgacgggcgtgatgcgccatgcggat
gccggctacgaactcgcgcagcagacggcccgcgaagccggcctgaagctgccgatgctc
ggccgctga

DBGET integrated database retrieval system