KEGG   Burkholderia lata: Bcep18194_A6006Help
Entry
Bcep18194_A6006   CDS       T00286                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bur  Burkholderia lata
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcep18194_A6006 (glpK)
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Bcep18194_A6006 (glpK)
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_A6006 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3140231..3141748
Genome map
AA seq 505 aa AA seqDB search
MEMRDMQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWST
QAGVAAEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQDRRTADFCDSL
KAQGFEAKVRAKTGLPIDSYFSGTKIRWILDNVPGAREKAKQGKLAFGTVDSWLVWNFTK
HELHVTDVTNASRTMLFNIHTREWDNELLDMLDIPRSMLPEVKASSEIYGHTKTTVFASK
IPLAGIAGDQQAALFGQMCTQSGMVKNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQIGD
NVQYALEGSIFIAGAVVQWLRDGVGIIKSAAEIEALAASVPHTDGVYLVPAFAGLGAPHW
NARARGSVFGVTRGTTSAHLARAALDSIAYQSLDVLAAMEADSGISIGELRVDGGASAND
LLMQFQADLLGVDAVRPQITETTALGAAYLAGLAIGYWKSLDDVRDQWQLDRRFSPSMPK
EHVERCMSGWQRAVRAAKAWADDAQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagagacatgcaggatcagtacatcctcgcgcttgaccagggcaccacgagt
tcccgcgcgatgctgttcgatcgccagggcaatatcgtttcgatcgcccagaaggaattc
gagcagatctacccgcaacccggctgggtcgagcacgatccgcaggaaatctggtcgacg
caagccggcgtcgccgccgaagccgtcacgcgcacgggcctgaacggcacgtcgatcgcc
gcgatcggcatcaccaaccagcgtgaaaccacgatcgtctgggatcgcgagacgggccag
cccgtctacaacgcgatcgtctggcaggatcgccgcacggccgacttctgcgattcgctg
aaagcacagggcttcgaggcgaaggtgcgtgcgaagaccggcctgccgatcgattcgtac
ttctcagggaccaagatccgctggattctcgacaacgtgccgggcgcacgcgagaaggcg
aagcagggcaagctcgcgttcggcaccgtcgacagctggctcgtgtggaacttcacgaag
cacgaactgcacgtgaccgacgtgacgaacgcgtcgcgtacgatgctgttcaacatccac
acgcgcgagtgggacaacgaactgctcgacatgctcgacatcccgcgcagcatgctgccg
gaagtgaaggcgtcgtcggaaatctacggccatacgaagaccaccgtgttcgcgtcgaag
atcccgctcgcgggtatcgcgggcgaccagcaggcggcgctgttcggccagatgtgcacg
cagtccggcatggtgaagaacacctacggtaccggctgcttcctgatgatgaacaccggc
gacaagccgatcgaatcgaagaacaacctcgtcacgacgatcgcgtggcagatcggcgac
aacgtgcagtacgcgctggaaggcagcatcttcatcgcgggcgcggtggtgcagtggctg
cgcgacggcgtcggcatcatcaagtcggccgccgagatcgaagcgctcgccgcaagcgtg
ccgcacaccgacggcgtctacctggtgcccgccttcgccggcctcggcgcaccgcactgg
aacgcgcgggcgcgcggctcggtgttcggcgtcacgcgcggcacaacctccgcgcacctc
gcacgcgcggcgctcgattcgatcgcgtaccagtcgctcgacgtgctggccgcgatggaa
gccgattcgggcatcagcatcggcgagctgcgcgtcgacggcggcgcgagcgcgaacgac
ctgctgatgcagttccaggcggacctgctcggcgttgacgcggtgcgtccgcagatcacc
gagacgaccgcgctcggcgcggcctacctcgcgggcctcgcgatcggctactggaagagc
ctcgacgacgtgcgcgaccagtggcagctcgatcgccgcttctcgccgtcgatgccgaag
gagcacgtcgaacgctgcatgtcgggctggcagcgtgcggtgcgtgccgcgaaggcatgg
gccgacgacgcccagtaa

DBGET integrated database retrieval system