KEGG   Burkholderia lata: Bcep18194_A6186Help
Entry
Bcep18194_A6186   CDS       T00286                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bur  Burkholderia lata
Pathway
bur00010  Glycolysis / Gluconeogenesis
bur00260  Glycine, serine and threonine metabolism
bur00680  Methane metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
bur01230  Biosynthesis of amino acids
Module
bur_M00002  Glycolysis, core module involving three-carbon compounds
bur_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_A6186
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_A6186
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_A6186
Enzymes [BR:bur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcep18194_A6186
Membrane trafficking [BR:bur04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bcep18194_A6186
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcep18194_A6186
  Exosomal proteins of melanoma cells
   Bcep18194_A6186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABB09780
UniProt: Q39CN6
Position
1:3332443..3333255
Genome map
AA seq 270 aa AA seqDB search
MAGPGRVLLDAPQLPSLPTARSMYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQ
AGELLKEAGYTFDIAYTSVLKRAIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNK
AETAAKFGDDQVLVWRRSYDTPPPALEATDERAPFNDPRYAKVPREQLPLTECLKDTVAR
VLPLWNESIAPAVRAGKQVLIAAHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDE
NLKPIKHYYLGDQDAIAQAQAAVAKQGKAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcccgggtcgggtcctgctcgacgcgccacagcttccttcactaccgaccgca
agatccatgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaac
cgcttcaccggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccag
gccggcgaattgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctc
aagcgcgcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgccg
gtcgtccactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaag
gcggaaacggccgcgaagttcggcgacgaccaggtgctcgtgtggcgccgcagctacgac
acgccgccgcccgcgctcgaggcgaccgacgaacgcgcgccgttcaacgacccgcgctac
gcgaaggtgccgcgcgagcaactgccgctcaccgagtgcctgaaggacacggtcgcgcgc
gtgctgccgctgtggaacgagtcgatcgccccggcggtccgcgccggcaagcaggtgctg
atcgccgcgcacggcaactcgctgcgcgcgttgatcaagtacctcgacggcatctcggac
agcgacatcgtcggcctgaacatcccgaacggcgtgccgctcgtgtatgagctcgacgaa
aacctgaagccgatcaagcactattacctcggcgaccaggacgcgatcgcgcaggcgcaa
gccgccgtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system