KEGG   Burkholderia lata: Bcep18194_A6186Help
Entry
Bcep18194_A6186   CDS       T00286                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bur  Burkholderia lata
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_A6186 (gpmA)
   01230 Biosynthesis of amino acids
    Bcep18194_A6186 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_A6186 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_A6186 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_A6186 (gpmA)
Enzymes [BR:bur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcep18194_A6186 (gpmA)
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcep18194_A6186 (gpmA)
  Exosomal proteins of melanoma cells
   Bcep18194_A6186 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3332443..3333255
Genome map
AA seq 270 aa AA seqDB search
MAGPGRVLLDAPQLPSLPTARSMYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQ
AGELLKEAGYTFDIAYTSVLKRAIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNK
AETAAKFGDDQVLVWRRSYDTPPPALEATDERAPFNDPRYAKVPREQLPLTECLKDTVAR
VLPLWNESIAPAVRAGKQVLIAAHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDE
NLKPIKHYYLGDQDAIAQAQAAVAKQGKAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcccgggtcgggtcctgctcgacgcgccacagcttccttcactaccgaccgca
agatccatgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaac
cgcttcaccggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccag
gccggcgaattgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctc
aagcgcgcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgccg
gtcgtccactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaag
gcggaaacggccgcgaagttcggcgacgaccaggtgctcgtgtggcgccgcagctacgac
acgccgccgcccgcgctcgaggcgaccgacgaacgcgcgccgttcaacgacccgcgctac
gcgaaggtgccgcgcgagcaactgccgctcaccgagtgcctgaaggacacggtcgcgcgc
gtgctgccgctgtggaacgagtcgatcgccccggcggtccgcgccggcaagcaggtgctg
atcgccgcgcacggcaactcgctgcgcgcgttgatcaagtacctcgacggcatctcggac
agcgacatcgtcggcctgaacatcccgaacggcgtgccgctcgtgtatgagctcgacgaa
aacctgaagccgatcaagcactattacctcggcgaccaggacgcgatcgcgcaggcgcaa
gccgccgtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system