KEGG   Burkholderia lata: Bcep18194_A6254Help
Entry
Bcep18194_A6254   CDS       T00286                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bur  Burkholderia lata
Pathway
bur00071  Fatty acid degradation
bur00280  Valine, leucine and isoleucine degradation
bur00281  Geraniol degradation
bur00310  Lysine degradation
bur00360  Phenylalanine metabolism
bur00362  Benzoate degradation
bur00380  Tryptophan metabolism
bur00410  beta-Alanine metabolism
bur00627  Aminobenzoate degradation
bur00640  Propanoate metabolism
bur00650  Butanoate metabolism
bur00903  Limonene and pinene degradation
bur00930  Caprolactam degradation
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01212  Fatty acid metabolism
Module
bur_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcep18194_A6254
   00650 Butanoate metabolism
    Bcep18194_A6254
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_A6254
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep18194_A6254
   00310 Lysine degradation
    Bcep18194_A6254
   00360 Phenylalanine metabolism
    Bcep18194_A6254
   00380 Tryptophan metabolism
    Bcep18194_A6254
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcep18194_A6254
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcep18194_A6254
   00281 Geraniol degradation
    Bcep18194_A6254
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep18194_A6254
   00627 Aminobenzoate degradation
    Bcep18194_A6254
   00930 Caprolactam degradation
    Bcep18194_A6254
Enzymes [BR:bur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcep18194_A6254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: ABB09848
UniProt: Q39CG8
Position
1:complement(3411547..3412374)
Genome map
AA seq 275 aa AA seqDB search
MANLAAYGGYEALKVTRRDHGVLDIVMSGEGTNRSGLATANARMHRELADIWRDVDRDPD
TRVAVIRGEGKGFSAGGDLALVEDMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLMLCEP
VSGEEAERIGLVSLAVEPADLLPKAYEVAERLAHGSQSAIRWTKYALNNWLRTAGPTFDT
SLALEFMGFAGPDVQEGIRSLRERRPPEFPGDAPF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctcgccgcgtacggcggttacgaagcactgaaggtgacgcgccgcgatcat
ggcgtgctcgacatcgtgatgagcggcgagggcacgaaccgcagcggcctcgcgaccgcg
aacgcgcgcatgcatcgcgagctcgccgacatctggcgcgacgtcgaccgcgatcccgac
acgcgcgtcgcggtgatccgtggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgaggacatggcgaacgacttcgacgtgcgcgcccgcgtgtggcgcgaggcgcgc
gacctcgtctacaacgtgatcaactgcagcaagccgatcgtctcggcgatgcatggcccg
gccgtcggcgcggggctcgtcgccgggctgctcgcggacatctcgatcgccgcgaaggat
gcacgcatcatcgacggccacacgcggctcggcgtcgcggcaggcgaccacgcggcgatc
gtgtggccgctgctgtgcgggatggcgaaggcgaagtactacctgatgctgtgcgagccg
gtgagcggcgaggaggccgagcggatcgggctggtatcgctcgcggtcgagccggccgac
ctgctgccgaaggcctacgaagtggccgagcggctcgcgcacggttcgcagtcggcgatc
cgctggaccaagtacgcattgaacaactggctgcgcacggccgggccgaccttcgatacg
tcgctcgcgctcgaattcatggggtttgccgggcccgacgtgcaggaaggcatccgctcg
ctgcgcgagcgccgtccgcccgagttccccggcgacgcgccgttctga

DBGET integrated database retrieval system