KEGG   Burkholderia lata: Bcep18194_B0029Help
Entry
Bcep18194_B0029   CDS       T00286                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bur  Burkholderia lata
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_B0029
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep18194_B0029
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep18194_B0029
Enzymes [BR:bur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcep18194_B0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(33311..35485)
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIENEALPGTGIDKAAFWSGFSALVHDLAPRNRELLAERDRLQQE
LDTWHRAHPGPVRDHAAYRAFLEQIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTATYNPTRGQRVIDYARNVLDNAAPLA
SGSHRDALRYRVQDGQLAVETAKGIVGLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEV
AKGGKSFTRRLNADREYTTPAGGTLSLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTVLCSLHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYNLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
QSYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKTPYASERAALLEGLLTVPVVERAAWSEAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QHGG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcgccagcgctgagccagttcattgaaaacgaa
gcgctgccgggcaccggcatcgacaaggccgcgttctggagcggtttctcggccctggtg
cacgacctggcgccgcgcaaccgcgaactgctcgcggaacgcgaccgcctgcagcaggaa
ctcgacacctggcaccgcgcgcaccccggccccgtgcgcgaccacgccgcgtatcgcgcg
ttcctcgaacaaatcggctacctcgtgccggtcccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgccacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctacgcgctgaacgccgcgaacgcccgctggggcagcctgtacgacgcgctgtac
ggcaccgatgcgctgcctgaagacggcggcgccgaacgcaccgcgacctacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcagcgccgctcgcg
agcggctcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgccgtcgaa
accgcgaagggcatcgtgggcctcgcgcagccggcgcagttcgtcggctaccagggcgcg
gccgacgcaccgtccgcgatcctgctgaagcacaacggcctgcacctcgagatccagatc
gacgcgtcgacgccgatcggccgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtggacgcagaagac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaaaagcttcacgcgccgcctgaacgccgatcgcgagtacaccacgccc
gccggcggcacgctgtcgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgagattccggaagggattctc
gacggcgtcgtcacggtgctgtgctcgctgcacgacctgaaggcgaagcgcaactcgcgc
acgggttcgatctacatcgtgaagccgaagatgcacggcccggtcgaagtcgcgttcgcc
gatacgctgttcgcgcgcatcgaggatctgtacaacctgccgcgcaacacgctgaagatg
ggcatcatggacgaggaacgccgcaccagcgtgaacctcgccgcgtgtatcgccgcggcc
gctgcgcgcgtggcgttcatcaacaccggcttcctcgatcgcaccggcgacgagatgcac
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
cagtcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgtgca
cagatcggcaagggcatgtgggcgatgccggacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcatgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccacctcgtcgacgtgcaggccgtccagcaggaactcgagaag
acgccgtacgcaagcgaacgcgccgcgctgctcgaaggcctgctgaccgtgccggtcgtc
gagcgcgccgcgtggagcgaggccgagatcctgagcgaagtcgagaacaacgcgcagggc
atcctcggctacgtcgtgcgctgggtcgaacagggcgtcggctgctcgaaggtgcccgac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgccacggcgtgatcaccgaggcgttcgtactcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgccggcgacccgaactatcgcccgatggcgccc
ggctacgaccagtcgaccgcgttcaaggccgcgtgtgcgctcgcgctgcagggcacgtcg
cagccgagcggctataccgagccgctgctgcaccggttccgcctcgcgttcaaggcgcaa
cagcacggcggttaa

DBGET integrated database retrieval system