KEGG   Burkholderia lata: Bcep18194_B0077Help
Entry
Bcep18194_B0077   CDS       T00286                                 

Definition
class II aldolase/adducin domain protein (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bur  Burkholderia lata
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bcep18194_B0077
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Bcep18194_B0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:84977..85759
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKEALVALAERRLDNAVGDSGWSARQKVALTCRILFDAGHDSGLAGQITCRAG
DAGTYYTQRLGLGFDEISAANLLRVNEDLDVVDGEGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISKALGSKRAIL
LSHHGQLVVGKTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREAHDWISKPKRD
AVTFDYYARRALRTHQDCVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgctgaatctgacgaaggaggcgctggtcgcgctggcggagcggcgtctc
gacaacgcggtgggcgacagcggctggtccgcgcggcagaaggtggcgctcacgtgccgg
atcctgttcgacgccggtcacgactcgggcctggccgggcagatcacctgccgcgcaggc
gacgccggcacgtactacacgcagcggctcgggctcggtttcgacgagatctcggcggcg
aacctgctgcgcgtcaatgaagatctcgacgtcgtcgacggcgagggcatcccgaatccg
gccaaccggtttcatacgtggatctaccgcgagcgcccggacgtgaactgcatcatccat
acccatccggcgcatgtcgcggcgctgtcgatgctcgagcagccgctcgtcgtgtcgcac
atggatacctgcccgctgtacgacgactgcgcgttcctgaaggactggcccggtgtgccg
gtcggcaacgaggagggcgagatcatctcgaaggcgctcggcagcaagcgcgcgatcctg
ctgtcgcatcacggccagctcgtggtcggcaagacgatcgaggaagcctgcatcctcgcg
ctgctgatcgagcgggccgcgaagctgcaactgctcgcgatgtcggccggcgagatcaag
ccggtgccgccggcgctggcgcgcgaagcgcacgactggatttcgaagccgaagcgcgat
gcggtgacgttcgactactacgcgcgcagggcattgcgtacgcatcaagactgtgtcgca
tga

DBGET integrated database retrieval system