KEGG   Burkholderia sp. 383: Bcep18194_B0366Help
Entry
Bcep18194_B0366   CDS       T00286                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bur  Burkholderia sp. 383
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bur00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(398061..399017)
Genome map
AA seq 318 aa AA seqDB search
MNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAEGLDACFVGVPFDLGTSNRTGARFGPR
QIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKP
ITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLH
GDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMEEVRARVGDTPVYISF
DIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAKGLNIVGCDLVEVAPPYDPFGTTALLG
ANLAYELLCVLPGVAYRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccacacccatttccagccgctcggcggcaatgaaatgccgcgctgcggcggc
atcgcgacgatgatgcgcctgccgcacgtggcgagcgccgaaggcctcgacgcctgtttc
gtcggcgtgccgttcgatctcggcacgtccaaccgcaccggcgcgcgcttcggcccgcgc
cagatccgcaccgaatccgtgctgctgcgcccgtacaacatggcgacgcgcgccgcgccg
ttcgattcgctgcagatcgccgacatcggcgacgtcgcgatcaatccgtacaacctgcac
gattccatcgcgcgcatcgaagccgcgtacgacgcgatcctcgaacacgactgcaagccg
atcacgctcggcggcgaccacacgatcgcgctgccgatcctgcgcgcgatccaccgcaag
cacggcaaggttgcattgatccacgtcgatgcacacgccgacgtgaacgacacgatgatg
ggtgaaaagatcgcgcacggcacgccgttccgccgcgcggtcgaggaaggcctgctgcac
ggcgacaaggtcacgcagatcggcctgcgcggcaccggctacgcggccgaggatttcgac
tggtgccgcgagcagggcttccgcgtcgtccaggcggaggaatgctggaacaagtcgctc
gcgccgctgatggaagaagtgcgcgcgcgcgtcggcgacacacccgtctacatcagcttc
gacatcgacggcatcgacccggcctacgcgccgggtaccggcacgccggaaatcgcgggc
ctcacggtgccgcaggcactcgagatcatccgcggcgcgaaggggctgaacatcgtcggc
tgcgatctcgtcgaagtcgcgccgccgtacgacccgttcggcaccacggcgctgctcggc
gcgaacctcgcgtacgagctgctgtgcgtgctgccgggcgtcgcctaccgcgactga

DBGET integrated database retrieval system