KEGG   Burkholderia lata: Bcep18194_B0610Help
Entry
Bcep18194_B0610   CDS       T00286                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bur  Burkholderia lata
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_B0610
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep18194_B0610
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bcep18194_B0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(682592..684175)
Genome map
AA seq 527 aa AA seqDB search
MAQYQDDIKAVAGLKENHGSAWNAISPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPAKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDATAKAAIQDKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTSTPGDLGDQYNAFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVSEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDALKAEGKDVSAYDRAQLMSVEYDETE
LAKLADEKIRTFQADAAREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGDAALKAAGKDNTMNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagttgccggtttgaaagaaaaccacggcagc
gcgtggaatgcgatcagccccgagtacgctgcccgcatgcgtgcccagaacaagttcaag
acgggcctggacatcgccaagtacaccgcgaagatcatgcgcgccgacatggccgcctac
gacgccgacccggccaagtacacgcagtcgctgggttgctggcacggcttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgaacgccgctacctgtacctg
tccggctggatggtcgctgcgctgcgttccgagttcggcccgctgccggaccagtcgatg
cacgaaaagacctcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgaactgggcggcctgttccgcgagctcgacgccgccaaggacgccacggcg
aaggcagcaatccaggacaagatcgacaaccacgtcacgcacgtcgtgccgatcatcgcc
gacatcgacgccggtttcggcaacgcggaagccacgtacctgctggccaagcaattcatc
gaagcaggcgcatgctgcatccagatcgaaaaccaggtgtccgacgagaagcagtgcggc
caccaggacggcaaggtcaccgtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcgttcctggaactgggcgtggacgacggcatcatcgtggcccgtaccgactcg
ctcggcgccggcctgaccaagcagatcgccgtgaccagcacgccgggcgacctgggcgac
cagtacaacgcgttcctcgattgcgaagaactgtcggccgaccaactgggcaacggtgac
gtcgtcatcaagcgcgacggcaagctgctgcgtccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcgcgctgcgtgctcgactgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgaaaccgaaaaaccgcacatcgcacagatcggcggc
atggtcagcgagatccgcaaggtcatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggcgtacgacgcgctgaaggccgagggc
aaggacgtgtcggcctacgaccgtgcgcagctgatgagcgtggaatacgacgagacggaa
ctggccaagctggccgacgagaagatccgtacgttccaggccgacgcagcgcgtgaagca
ggcatcttccatcacctgatcacgctgccgacgtaccacaccgccgcgctgtcgaccgac
aacctggccaaggaatacttcggcgaccagggcatgctgggctacgtggccggcgtgcag
cgcaaggaaatccgccagggtatcgcctgcgtgaagcaccagaacatgtccggttcggac
atcggtgacgatcacaaggaatacttcagcggcgacgcagcgctgaaggcagcaggcaag
gacaacacgatgaaccagttctga

DBGET integrated database retrieval system